Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R4F0

Protein Details
Accession A0A0J8R4F0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
9-28RLAGLKRVSRRDKKVQASPDHydrophilic
NLS Segment(s)
PositionSequence
5-22RRRERLAGLKRVSRRDKK
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8, pero 2
Family & Domain DBs
Amino Acid Sequences MRDVRRRERLAGLKRVSRRDKKVQASPDAKSPDSGKQLLRPRSGAPLGVGSTIVIPTRSRKPPSWNPPIIGSLSDHVPSPFSEPGVSYFDPFWSLPGFDDIKPVVDRLMKHLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.76
4 0.75
5 0.75
6 0.75
7 0.78
8 0.79
9 0.81
10 0.78
11 0.78
12 0.74
13 0.67
14 0.64
15 0.59
16 0.51
17 0.44
18 0.39
19 0.35
20 0.35
21 0.35
22 0.29
23 0.32
24 0.41
25 0.45
26 0.44
27 0.4
28 0.37
29 0.39
30 0.39
31 0.31
32 0.23
33 0.19
34 0.17
35 0.15
36 0.14
37 0.08
38 0.08
39 0.07
40 0.07
41 0.05
42 0.05
43 0.09
44 0.15
45 0.21
46 0.24
47 0.27
48 0.36
49 0.45
50 0.54
51 0.61
52 0.57
53 0.54
54 0.52
55 0.51
56 0.43
57 0.33
58 0.25
59 0.17
60 0.15
61 0.14
62 0.12
63 0.1
64 0.1
65 0.1
66 0.13
67 0.12
68 0.12
69 0.12
70 0.12
71 0.15
72 0.2
73 0.2
74 0.17
75 0.16
76 0.16
77 0.19
78 0.18
79 0.16
80 0.12
81 0.12
82 0.12
83 0.16
84 0.19
85 0.16
86 0.2
87 0.19
88 0.22
89 0.22
90 0.21
91 0.2
92 0.21
93 0.22