Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R1P4

Protein Details
Accession A0A0J8R1P4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-134SDDIVKPSRTKRRRHNEEVKTPLRQNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MFVILQPLAHRSRSKAAVKREPISSSPTPLRIIKSEPSSDEDEDPIRAPGSAFRCRRFSLREVKQEPSSDDDDEEEEDTVRAPHPSRRTGKRPIVGSSDDSGGQEDSDSDDIVKPSRTKRRRHNEEVKTPLRQNAEQGDTPLSRPANLDKSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.59
4 0.64
5 0.7
6 0.69
7 0.66
8 0.62
9 0.55
10 0.55
11 0.47
12 0.43
13 0.4
14 0.38
15 0.37
16 0.36
17 0.37
18 0.32
19 0.34
20 0.33
21 0.34
22 0.34
23 0.32
24 0.34
25 0.35
26 0.34
27 0.31
28 0.28
29 0.23
30 0.22
31 0.2
32 0.17
33 0.13
34 0.11
35 0.1
36 0.13
37 0.18
38 0.25
39 0.28
40 0.31
41 0.35
42 0.36
43 0.4
44 0.4
45 0.4
46 0.42
47 0.46
48 0.53
49 0.53
50 0.55
51 0.55
52 0.51
53 0.47
54 0.41
55 0.35
56 0.25
57 0.21
58 0.18
59 0.15
60 0.15
61 0.14
62 0.09
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.12
71 0.16
72 0.24
73 0.31
74 0.39
75 0.45
76 0.53
77 0.59
78 0.6
79 0.58
80 0.54
81 0.51
82 0.46
83 0.42
84 0.34
85 0.28
86 0.23
87 0.2
88 0.18
89 0.13
90 0.11
91 0.08
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.1
99 0.11
100 0.14
101 0.16
102 0.23
103 0.34
104 0.42
105 0.5
106 0.6
107 0.7
108 0.77
109 0.84
110 0.87
111 0.87
112 0.89
113 0.9
114 0.85
115 0.8
116 0.73
117 0.68
118 0.62
119 0.53
120 0.47
121 0.45
122 0.45
123 0.39
124 0.38
125 0.38
126 0.33
127 0.33
128 0.34
129 0.28
130 0.23
131 0.24
132 0.29
133 0.32