Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R3J0

Protein Details
Accession A0A0J8R3J0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-48SDDDDKPLIRRRRSRRKELTTGTQSHydrophilic
NLS Segment(s)
PositionSequence
33-40RRRRSRRK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
PROSITE View protein in PROSITE  
PS50097  BTB  
Amino Acid Sequences MSSRYPQRDRDQPALGKLDNTISSDDDDKPLIRRRRSRRKELTTGTQSLARERHLIIGVRIGSAPEEFLIHPHFLIKESKLFNTRLQSPSTKTLELADVQPDLFCTFVDWLYRDCLPSQENEADPTQYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.45
4 0.38
5 0.34
6 0.27
7 0.25
8 0.21
9 0.16
10 0.18
11 0.2
12 0.19
13 0.17
14 0.17
15 0.17
16 0.2
17 0.29
18 0.35
19 0.4
20 0.49
21 0.59
22 0.69
23 0.77
24 0.83
25 0.85
26 0.85
27 0.87
28 0.84
29 0.83
30 0.77
31 0.71
32 0.61
33 0.54
34 0.45
35 0.39
36 0.34
37 0.25
38 0.2
39 0.18
40 0.19
41 0.17
42 0.18
43 0.14
44 0.17
45 0.15
46 0.14
47 0.13
48 0.11
49 0.09
50 0.08
51 0.08
52 0.04
53 0.05
54 0.05
55 0.06
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.11
63 0.11
64 0.15
65 0.17
66 0.2
67 0.22
68 0.24
69 0.26
70 0.29
71 0.34
72 0.31
73 0.33
74 0.33
75 0.34
76 0.39
77 0.39
78 0.34
79 0.29
80 0.28
81 0.27
82 0.25
83 0.22
84 0.17
85 0.14
86 0.13
87 0.13
88 0.12
89 0.11
90 0.09
91 0.08
92 0.08
93 0.08
94 0.1
95 0.12
96 0.13
97 0.14
98 0.17
99 0.19
100 0.18
101 0.18
102 0.2
103 0.19
104 0.21
105 0.25
106 0.27
107 0.27
108 0.29
109 0.3