Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R887

Protein Details
Accession A0A0J8R887    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-35AEGDEKPPRNKGRKLKMPSKPRLGNSBasic
NLS Segment(s)
PositionSequence
14-33EKPPRNKGRKLKMPSKPRLG
93-103SRKRGRAKKTS
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPVKSASKSAEGDEKPPRNKGRKLKMPSKPRLGNSIAAARASNKTPALMRKFLEAGDTKGGAKVVSDTIKPGRKTRAARTADVRSSPDNVPVSRKRGRAKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.55
4 0.62
5 0.61
6 0.69
7 0.73
8 0.74
9 0.76
10 0.81
11 0.83
12 0.83
13 0.85
14 0.85
15 0.85
16 0.8
17 0.72
18 0.7
19 0.62
20 0.56
21 0.48
22 0.44
23 0.34
24 0.28
25 0.26
26 0.21
27 0.2
28 0.18
29 0.17
30 0.12
31 0.13
32 0.14
33 0.21
34 0.24
35 0.25
36 0.24
37 0.24
38 0.24
39 0.23
40 0.24
41 0.18
42 0.16
43 0.15
44 0.15
45 0.13
46 0.13
47 0.13
48 0.1
49 0.09
50 0.08
51 0.09
52 0.1
53 0.1
54 0.13
55 0.19
56 0.26
57 0.28
58 0.31
59 0.35
60 0.41
61 0.47
62 0.53
63 0.56
64 0.54
65 0.57
66 0.6
67 0.61
68 0.58
69 0.55
70 0.5
71 0.42
72 0.42
73 0.38
74 0.37
75 0.33
76 0.3
77 0.36
78 0.39
79 0.44
80 0.47
81 0.53
82 0.57
83 0.62