Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8U595

Protein Details
Accession A0A0J8U595    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MAAPNPPRQRKPQQPSKPEKRKAGPNANPQTRKRHydrophilic
NLS Segment(s)
PositionSequence
7-36PRQRKPQQPSKPEKRKAGPNANPQTRKRAK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039182  Pop1  
IPR009723  Pop1_N  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF06978  POP1  
Amino Acid Sequences MAAPNPPRQRKPQQPSKPEKRKAGPNANPQTRKRAKTHDARTLAVQSSEAALSKTGELDVSAFVAARQYEIRALEAGIRSAKNALTSRAFQKVPRALRRRTASHNVKRCQGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.91
3 0.93
4 0.93
5 0.91
6 0.9
7 0.86
8 0.85
9 0.85
10 0.85
11 0.83
12 0.83
13 0.85
14 0.85
15 0.85
16 0.77
17 0.77
18 0.74
19 0.7
20 0.64
21 0.63
22 0.62
23 0.64
24 0.71
25 0.69
26 0.65
27 0.61
28 0.58
29 0.51
30 0.44
31 0.33
32 0.25
33 0.16
34 0.13
35 0.12
36 0.09
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.08
57 0.09
58 0.1
59 0.09
60 0.09
61 0.11
62 0.11
63 0.12
64 0.13
65 0.12
66 0.12
67 0.13
68 0.13
69 0.16
70 0.17
71 0.19
72 0.2
73 0.23
74 0.27
75 0.32
76 0.33
77 0.29
78 0.37
79 0.42
80 0.47
81 0.55
82 0.58
83 0.58
84 0.66
85 0.72
86 0.69
87 0.7
88 0.71
89 0.72
90 0.75
91 0.8
92 0.76