Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8TPN9

Protein Details
Accession A0A0J8TPN9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
273-292LMEFKKKWPRHPGKLIVQDLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 8, cysk 7, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016461  COMT-like  
IPR001077  O_MeTrfase_dom  
IPR029063  SAM-dependent_MTases_sf  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0008171  F:O-methyltransferase activity  
GO:0032259  P:methylation  
GO:0044550  P:secondary metabolite biosynthetic process  
Pfam View protein in Pfam  
PF00891  Methyltransf_2  
PROSITE View protein in PROSITE  
PS51683  SAM_OMT_II  
Amino Acid Sequences MGEPSRVDTFEQNGLTAGNVLDESIAVLPNAGEDVPQLLHAVAAFGEEYAAEPRSRMKLLEAARSLVYALETPREAMIRYCWAQSSIFGAIETGIDMGLFHILAKDDKPKTVSELANATKSDPTLLSRILKHLAAMGVVVEAGADLYRPNGLSKTLTIKKYFDGWPCMTGCVTSAAHTMPEFFKKRGYNNPNNIKDSPFQMGFNTDLNFFEYLGANPKVGSEFNNHMSAYHQGRSSWMDPGFFPVEGRLFDGAKAEADAPLIVDVGGSLGHDLMEFKKKWPRHPGKLIVQDLPEVIKETRKTVDPNITAMEHDFFKDQPIKGARAYFMHSILHDWPDDIAVKILTNLVKAMEPGYSRLLINENVIPDIDAYWETTSLDIIMLALFSSQERTAKHWHQLLGSVGLKIVNIWTVEKGTESLIECEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.13
5 0.08
6 0.07
7 0.07
8 0.07
9 0.06
10 0.07
11 0.07
12 0.07
13 0.06
14 0.07
15 0.06
16 0.06
17 0.08
18 0.06
19 0.05
20 0.05
21 0.08
22 0.08
23 0.08
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.06
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.08
37 0.1
38 0.09
39 0.1
40 0.14
41 0.18
42 0.2
43 0.19
44 0.2
45 0.25
46 0.3
47 0.38
48 0.36
49 0.34
50 0.33
51 0.32
52 0.3
53 0.23
54 0.19
55 0.12
56 0.12
57 0.12
58 0.12
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.16
65 0.19
66 0.21
67 0.21
68 0.21
69 0.22
70 0.22
71 0.21
72 0.22
73 0.17
74 0.16
75 0.14
76 0.13
77 0.12
78 0.11
79 0.11
80 0.07
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.06
90 0.07
91 0.09
92 0.17
93 0.18
94 0.21
95 0.23
96 0.23
97 0.27
98 0.33
99 0.32
100 0.27
101 0.33
102 0.32
103 0.34
104 0.34
105 0.3
106 0.24
107 0.23
108 0.21
109 0.15
110 0.15
111 0.14
112 0.17
113 0.19
114 0.19
115 0.22
116 0.23
117 0.22
118 0.2
119 0.19
120 0.16
121 0.12
122 0.11
123 0.08
124 0.06
125 0.06
126 0.05
127 0.03
128 0.03
129 0.03
130 0.02
131 0.02
132 0.02
133 0.03
134 0.04
135 0.04
136 0.05
137 0.06
138 0.08
139 0.09
140 0.11
141 0.19
142 0.25
143 0.28
144 0.29
145 0.3
146 0.3
147 0.34
148 0.37
149 0.32
150 0.33
151 0.31
152 0.31
153 0.31
154 0.3
155 0.25
156 0.2
157 0.17
158 0.14
159 0.13
160 0.1
161 0.11
162 0.1
163 0.11
164 0.1
165 0.12
166 0.1
167 0.16
168 0.18
169 0.18
170 0.23
171 0.26
172 0.3
173 0.39
174 0.47
175 0.5
176 0.57
177 0.67
178 0.67
179 0.68
180 0.65
181 0.57
182 0.49
183 0.42
184 0.35
185 0.26
186 0.21
187 0.16
188 0.17
189 0.15
190 0.16
191 0.14
192 0.11
193 0.1
194 0.11
195 0.11
196 0.1
197 0.09
198 0.08
199 0.08
200 0.12
201 0.12
202 0.11
203 0.1
204 0.1
205 0.1
206 0.1
207 0.11
208 0.1
209 0.13
210 0.16
211 0.18
212 0.18
213 0.17
214 0.18
215 0.21
216 0.2
217 0.19
218 0.17
219 0.15
220 0.17
221 0.2
222 0.2
223 0.21
224 0.18
225 0.17
226 0.16
227 0.2
228 0.2
229 0.16
230 0.15
231 0.11
232 0.12
233 0.11
234 0.13
235 0.1
236 0.09
237 0.1
238 0.11
239 0.1
240 0.09
241 0.09
242 0.08
243 0.07
244 0.07
245 0.06
246 0.05
247 0.05
248 0.05
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.04
260 0.06
261 0.13
262 0.14
263 0.17
264 0.25
265 0.29
266 0.37
267 0.47
268 0.55
269 0.58
270 0.67
271 0.73
272 0.75
273 0.8
274 0.76
275 0.68
276 0.58
277 0.49
278 0.4
279 0.32
280 0.23
281 0.16
282 0.13
283 0.15
284 0.15
285 0.17
286 0.19
287 0.21
288 0.24
289 0.27
290 0.36
291 0.32
292 0.34
293 0.33
294 0.32
295 0.29
296 0.27
297 0.23
298 0.15
299 0.14
300 0.13
301 0.11
302 0.15
303 0.21
304 0.2
305 0.25
306 0.28
307 0.3
308 0.31
309 0.34
310 0.31
311 0.27
312 0.31
313 0.26
314 0.23
315 0.22
316 0.2
317 0.21
318 0.21
319 0.21
320 0.17
321 0.15
322 0.14
323 0.14
324 0.15
325 0.12
326 0.11
327 0.09
328 0.09
329 0.09
330 0.12
331 0.11
332 0.11
333 0.11
334 0.11
335 0.11
336 0.11
337 0.11
338 0.11
339 0.12
340 0.14
341 0.16
342 0.17
343 0.16
344 0.17
345 0.2
346 0.18
347 0.2
348 0.2
349 0.18
350 0.17
351 0.17
352 0.16
353 0.13
354 0.12
355 0.11
356 0.09
357 0.1
358 0.1
359 0.1
360 0.1
361 0.1
362 0.1
363 0.09
364 0.08
365 0.06
366 0.06
367 0.05
368 0.05
369 0.04
370 0.04
371 0.04
372 0.05
373 0.08
374 0.09
375 0.13
376 0.15
377 0.19
378 0.29
379 0.34
380 0.42
381 0.45
382 0.46
383 0.45
384 0.48
385 0.46
386 0.44
387 0.39
388 0.32
389 0.27
390 0.24
391 0.22
392 0.18
393 0.16
394 0.11
395 0.11
396 0.12
397 0.14
398 0.15
399 0.15
400 0.16
401 0.16
402 0.15
403 0.18
404 0.18
405 0.19