Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QQY9

Protein Details
Accession A0A0J8QQY9   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-131RYRLCNRKFSNSGQRNKRRQSRRCFLNGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 8, extr 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MPLFRPTLPSNVLLSLKDLFRFHLIPGLSLALCGPFLEHGPSLMARLRRGTTSPLRTQTSWGYHRFQRSSGTRGGHVANILTRQVGQIKAEVYAHLLTIRLSRRYRLCNRKFSNSGQRNKRRQSRRCFLNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.22
4 0.22
5 0.21
6 0.19
7 0.21
8 0.22
9 0.19
10 0.22
11 0.21
12 0.18
13 0.19
14 0.19
15 0.14
16 0.13
17 0.13
18 0.08
19 0.08
20 0.07
21 0.06
22 0.05
23 0.06
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.13
31 0.14
32 0.13
33 0.16
34 0.17
35 0.17
36 0.18
37 0.23
38 0.27
39 0.32
40 0.36
41 0.39
42 0.41
43 0.4
44 0.41
45 0.39
46 0.38
47 0.36
48 0.34
49 0.32
50 0.32
51 0.37
52 0.35
53 0.32
54 0.32
55 0.31
56 0.31
57 0.32
58 0.3
59 0.26
60 0.27
61 0.27
62 0.21
63 0.18
64 0.15
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.08
71 0.1
72 0.1
73 0.1
74 0.11
75 0.11
76 0.12
77 0.12
78 0.12
79 0.12
80 0.11
81 0.1
82 0.09
83 0.09
84 0.08
85 0.13
86 0.16
87 0.21
88 0.23
89 0.28
90 0.35
91 0.44
92 0.54
93 0.61
94 0.66
95 0.7
96 0.75
97 0.79
98 0.77
99 0.76
100 0.77
101 0.76
102 0.77
103 0.77
104 0.81
105 0.82
106 0.87
107 0.89
108 0.88
109 0.89
110 0.9
111 0.89