Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8TUG3

Protein Details
Accession A0A0J8TUG3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-81PAPSSTTRRRPTKKPRRSKNSPEPDYSHydrophilic
NLS Segment(s)
PositionSequence
62-73RRRPTKKPRRSK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTSSNKREAQESPNGRQQQKKEDWEAFINLEGSDQTAEEAMNGEEEKQPEAQEAPAPSSTTRRRPTKKPRRSKNSPEPDYSAMVQGQMAGTHRTGQACDRCKVLSRASSSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.63
4 0.61
5 0.61
6 0.63
7 0.63
8 0.62
9 0.58
10 0.58
11 0.54
12 0.51
13 0.41
14 0.34
15 0.28
16 0.2
17 0.16
18 0.12
19 0.1
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.11
43 0.12
44 0.11
45 0.18
46 0.21
47 0.27
48 0.34
49 0.42
50 0.47
51 0.57
52 0.68
53 0.73
54 0.8
55 0.82
56 0.86
57 0.87
58 0.91
59 0.91
60 0.91
61 0.91
62 0.85
63 0.79
64 0.73
65 0.65
66 0.58
67 0.48
68 0.39
69 0.28
70 0.23
71 0.18
72 0.13
73 0.11
74 0.09
75 0.09
76 0.09
77 0.1
78 0.12
79 0.14
80 0.14
81 0.15
82 0.22
83 0.29
84 0.33
85 0.34
86 0.34
87 0.34
88 0.39
89 0.42
90 0.42
91 0.4
92 0.41