Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QLE4

Protein Details
Accession A0A0J8QLE4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34EEAPKKAEKKEEPKKQWFMIHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MCLECCFPYRSLIIEEAPKKAEKKEEPKKQWFMIEPGDTMYPAAFYQYGFVEPNRRTADPPNIPSEPILYQYIPAGQRPADPPAPTPLRNDAPAPATIHMTQQIYTTGAIVLPPYPISLKLIPFYMSFLWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.32
5 0.34
6 0.32
7 0.33
8 0.39
9 0.4
10 0.49
11 0.56
12 0.65
13 0.71
14 0.79
15 0.82
16 0.76
17 0.72
18 0.64
19 0.58
20 0.53
21 0.45
22 0.36
23 0.31
24 0.28
25 0.22
26 0.19
27 0.15
28 0.09
29 0.07
30 0.07
31 0.06
32 0.05
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.15
39 0.15
40 0.23
41 0.25
42 0.25
43 0.25
44 0.29
45 0.38
46 0.37
47 0.39
48 0.37
49 0.34
50 0.33
51 0.32
52 0.29
53 0.2
54 0.17
55 0.16
56 0.1
57 0.1
58 0.1
59 0.13
60 0.12
61 0.12
62 0.11
63 0.1
64 0.12
65 0.14
66 0.18
67 0.17
68 0.17
69 0.18
70 0.25
71 0.29
72 0.27
73 0.28
74 0.3
75 0.3
76 0.31
77 0.3
78 0.25
79 0.23
80 0.24
81 0.24
82 0.19
83 0.19
84 0.18
85 0.18
86 0.19
87 0.18
88 0.16
89 0.15
90 0.15
91 0.14
92 0.13
93 0.12
94 0.09
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.1
104 0.14
105 0.17
106 0.19
107 0.2
108 0.21
109 0.22
110 0.21
111 0.23