Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8R7S2

Protein Details
Accession A0A0J8R7S2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-114LAQLRQRRERERERERERSRDDKRKEBasic
NLS Segment(s)
PositionSequence
85-114RRRGLAQLRQRRERERERERERSRDDKRKE
Subcellular Location(s) nucl 12, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MYAPETTKVRFATGESRCALANETRQGEKQFRGVEQGKVGWLLDFATGLLGRCLDLLEIRAGALVVRLTTRSTPEGTDVEETRERRRGLAQLRQRRERERERERERSRDDKRKESGAPWYRTQTPQRMTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.31
4 0.29
5 0.29
6 0.29
7 0.24
8 0.26
9 0.27
10 0.3
11 0.31
12 0.33
13 0.37
14 0.38
15 0.36
16 0.35
17 0.31
18 0.29
19 0.34
20 0.34
21 0.33
22 0.31
23 0.3
24 0.24
25 0.22
26 0.22
27 0.13
28 0.11
29 0.09
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.04
52 0.03
53 0.04
54 0.04
55 0.05
56 0.06
57 0.08
58 0.09
59 0.1
60 0.1
61 0.13
62 0.13
63 0.14
64 0.16
65 0.14
66 0.17
67 0.21
68 0.22
69 0.24
70 0.29
71 0.28
72 0.27
73 0.29
74 0.32
75 0.35
76 0.43
77 0.49
78 0.53
79 0.61
80 0.69
81 0.71
82 0.72
83 0.74
84 0.75
85 0.75
86 0.75
87 0.78
88 0.78
89 0.84
90 0.83
91 0.84
92 0.81
93 0.81
94 0.81
95 0.8
96 0.79
97 0.77
98 0.76
99 0.73
100 0.69
101 0.63
102 0.63
103 0.63
104 0.61
105 0.57
106 0.58
107 0.56
108 0.6
109 0.63
110 0.62