FuNGI

A0A0J8QRC6

Protein Details

Accession

A0A0J8QRC6

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
117-138	KSPENTKPPRHASQRKTPKEAC	Hydrophilic
224-250	DEVKRRFYKNWYKSKKKAFTKYAKSYS	Hydrophilic
342-364	VTSRWGTKKLPRKTHKGLRKVAC	Hydrophilic

NLS Segment(s)

Position	Sequence
350-357	KLPRKTHK

Subcellular Location(s)

mito 25

Family & Domain DBs

InterPro	View protein in InterPro IPR045077 L3_arc_euk IPR000597 Ribosomal_L3 IPR019926 Ribosomal_L3_CS IPR009000 Transl_B-barrel_sf
Gene Ontology	GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF00297 Ribosomal_L3
PROSITE	View protein in PROSITE PS00474 RIBOSOMAL_L3

Amino Acid Sequences

MSAPNRSIVKCIVHPFMAQAQATAQHANCSPYILTYLSVDGKPISRTTISSEEPPLHAYPPPYVSFSQSSSDVNSICGLVARSAVARADRSERNQARSAPRQLEETAAKCHGADRWKSPENTKPPRHASQRKTPKEACPTFTAAIGLQGPGMTHHPSAILIVLVPRCTRRRSLRPSPLSKLLRLRPSAVTNWTLTDDPVGIVGYIETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKSYSENKGASVTRELERIKKYCTVVRLLAHTQIRKTPLKQKKAHLMEIQVNGGSVPEKVDFAHGLFEKPIEIDSVFEQDEMIDVIAVTKGHGFQGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQDGYHHRTSVNHKIYRIGKGSDEGNASTDFDVSKKQITPMGGFVRYGEVKNDFIILKGSCPGVKKRVLTLRKTLFPQVSRKALEKVELKWIDTSSKFGHGAYQTAAEKRAFMGTLKKDLAAAP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.37
3	0.38
4	0.38
5	0.31
6	0.26
7	0.23
8	0.24
9	0.26
10	0.26
11	0.21
12	0.19
13	0.21
14	0.23
15	0.22
16	0.22
17	0.2
18	0.17
19	0.19
20	0.16
21	0.16
22	0.14
23	0.18
24	0.19
25	0.18
26	0.18
27	0.17
28	0.19
29	0.21
30	0.2
31	0.21
32	0.19
33	0.2
34	0.26
35	0.31
36	0.31
37	0.33
38	0.36
39	0.34
40	0.34
41	0.37
42	0.32
43	0.27
44	0.27
45	0.24
46	0.24
47	0.26
48	0.26
49	0.26
50	0.26
51	0.28
52	0.29
53	0.29
54	0.29
55	0.26
56	0.25
57	0.24
58	0.26
59	0.22
60	0.2
61	0.18
62	0.15
63	0.13
64	0.13
65	0.11
66	0.09
67	0.09
68	0.09
69	0.09
70	0.1
71	0.11
72	0.12
73	0.13
74	0.15
75	0.21
76	0.25
77	0.3
78	0.4
79	0.43
80	0.47
81	0.51
82	0.55
83	0.57
84	0.61
85	0.64
86	0.59
87	0.55
88	0.53
89	0.49
90	0.48
91	0.44
92	0.37
93	0.34
94	0.29
95	0.28
96	0.24
97	0.25
98	0.23
99	0.26
100	0.28
101	0.3
102	0.37
103	0.43
104	0.46
105	0.49
106	0.54
107	0.58
108	0.64
109	0.64
110	0.65
111	0.66
112	0.72
113	0.78
114	0.78
115	0.76
116	0.76
117	0.8
118	0.79
119	0.81
120	0.77
121	0.75
122	0.76
123	0.72
124	0.65
125	0.58
126	0.55
127	0.47
128	0.43
129	0.35
130	0.24
131	0.21
132	0.18
133	0.13
134	0.08
135	0.08
136	0.07
137	0.07
138	0.1
139	0.1
140	0.09
141	0.09
142	0.1
143	0.1
144	0.1
145	0.09
146	0.07
147	0.05
148	0.08
149	0.08
150	0.09
151	0.1
152	0.15
153	0.18
154	0.2
155	0.27
156	0.34
157	0.43
158	0.52
159	0.62
160	0.68
161	0.75
162	0.79
163	0.78
164	0.78
165	0.71
166	0.66
167	0.63
168	0.58
169	0.56
170	0.5
171	0.47
172	0.41
173	0.41
174	0.4
175	0.35
176	0.31
177	0.25
178	0.24
179	0.23
180	0.19
181	0.16
182	0.14
183	0.11
184	0.08
185	0.08
186	0.07
187	0.05
188	0.05
189	0.05
190	0.05
191	0.05
192	0.05
193	0.05
194	0.05
195	0.06
196	0.06
197	0.07
198	0.05
199	0.08
200	0.09
201	0.12
202	0.13
203	0.13
204	0.13
205	0.15
206	0.15
207	0.12
208	0.11
209	0.1
210	0.1
211	0.15
212	0.17
213	0.2
214	0.22
215	0.24
216	0.27
217	0.35
218	0.44
219	0.49
220	0.57
221	0.63
222	0.7
223	0.76
224	0.83
225	0.84
226	0.82
227	0.81
228	0.8
229	0.8
230	0.81
231	0.82
232	0.79
233	0.73
234	0.68
235	0.65
236	0.6
237	0.58
238	0.49
239	0.4
240	0.35
241	0.32
242	0.3
243	0.26
244	0.23
245	0.16
246	0.2
247	0.2
248	0.22
249	0.26
250	0.27
251	0.27
252	0.28
253	0.3
254	0.28
255	0.3
256	0.28
257	0.27
258	0.27
259	0.28
260	0.25
261	0.29
262	0.3
263	0.28
264	0.26
265	0.26
266	0.3
267	0.28
268	0.31
269	0.36
270	0.42
271	0.5
272	0.55
273	0.58
274	0.63
275	0.65
276	0.67
277	0.6
278	0.55
279	0.51
280	0.47
281	0.41
282	0.31
283	0.25
284	0.19
285	0.16
286	0.12
287	0.06
288	0.06
289	0.05
290	0.06
291	0.06
292	0.08
293	0.08
294	0.08
295	0.12
296	0.12
297	0.12
298	0.12
299	0.12
300	0.11
301	0.1
302	0.1
303	0.07
304	0.07
305	0.07
306	0.07
307	0.1
308	0.1
309	0.1
310	0.09
311	0.08
312	0.08
313	0.07
314	0.06
315	0.04
316	0.03
317	0.04
318	0.05
319	0.05
320	0.05
321	0.05
322	0.05
323	0.06
324	0.07
325	0.07
326	0.07
327	0.14
328	0.15
329	0.17
330	0.18
331	0.21
332	0.2
333	0.25
334	0.27
335	0.28
336	0.37
337	0.45
338	0.55
339	0.59
340	0.68
341	0.74
342	0.81
343	0.82
344	0.82
345	0.82
346	0.78
347	0.78
348	0.72
349	0.63
350	0.55
351	0.48
352	0.39
353	0.37
354	0.31
355	0.25
356	0.22
357	0.21
358	0.22
359	0.21
360	0.22
361	0.15
362	0.18
363	0.19
364	0.2
365	0.19
366	0.17
367	0.17
368	0.16
369	0.2
370	0.23
371	0.27
372	0.27
373	0.27
374	0.27
375	0.31
376	0.37
377	0.43
378	0.47
379	0.44
380	0.42
381	0.5
382	0.54
383	0.56
384	0.53
385	0.44
386	0.36
387	0.35
388	0.35
389	0.32
390	0.29
391	0.23
392	0.2
393	0.19
394	0.18
395	0.16
396	0.15
397	0.12
398	0.11
399	0.14
400	0.13
401	0.17
402	0.17
403	0.19
404	0.22
405	0.24
406	0.26
407	0.29
408	0.33
409	0.3
410	0.29
411	0.28
412	0.29
413	0.29
414	0.27
415	0.24
416	0.21
417	0.21
418	0.21
419	0.23
420	0.18
421	0.16
422	0.2
423	0.17
424	0.15
425	0.16
426	0.18
427	0.17
428	0.21
429	0.27
430	0.3
431	0.36
432	0.37
433	0.44
434	0.53
435	0.58
436	0.61
437	0.65
438	0.65
439	0.65
440	0.67
441	0.66
442	0.63
443	0.6
444	0.63
445	0.61
446	0.6
447	0.57
448	0.57
449	0.55
450	0.49
451	0.51
452	0.47
453	0.42
454	0.45
455	0.44
456	0.42
457	0.4
458	0.39
459	0.38
460	0.34
461	0.36
462	0.29
463	0.32
464	0.31
465	0.28
466	0.33
467	0.28
468	0.3
469	0.27
470	0.3
471	0.28
472	0.3
473	0.33
474	0.27
475	0.26
476	0.25
477	0.26
478	0.21
479	0.2
480	0.27
481	0.29
482	0.36
483	0.37
484	0.36

A0A0J8QRC6

3D AlphaFold-predicted Structure Viewer