Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R095

Protein Details
Accession A0A0J8R095    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-155ANTTSGRIKKRSSRQRKPYRTLMTKLVHydrophilic
NLS Segment(s)
PositionSequence
137-145KKRSSRQRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019404  Mediator_Med11  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10280  Med11  
Amino Acid Sequences MESQEPDHAFSAADRIEQLNEIDRDATKLLRAAGFAVQALTNIPLSNGGTKDSHSPSSKSALEAHQEAFKAASSQYFALLSSIDVRLRRQVYALEEASIIRPETTTKTAEGSGTAAFNPLETSWLNIPANTTSGRIKKRSSRQRKPYRTLMTKLVALMQAEDPNADTKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.15
5 0.16
6 0.18
7 0.18
8 0.18
9 0.19
10 0.18
11 0.19
12 0.19
13 0.19
14 0.13
15 0.14
16 0.15
17 0.14
18 0.14
19 0.14
20 0.14
21 0.14
22 0.13
23 0.12
24 0.1
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.11
34 0.11
35 0.12
36 0.12
37 0.13
38 0.18
39 0.2
40 0.24
41 0.24
42 0.25
43 0.25
44 0.3
45 0.29
46 0.26
47 0.25
48 0.23
49 0.23
50 0.23
51 0.22
52 0.19
53 0.19
54 0.17
55 0.15
56 0.12
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.06
68 0.06
69 0.07
70 0.08
71 0.09
72 0.09
73 0.14
74 0.15
75 0.15
76 0.14
77 0.15
78 0.16
79 0.21
80 0.2
81 0.16
82 0.15
83 0.15
84 0.15
85 0.14
86 0.11
87 0.06
88 0.06
89 0.07
90 0.1
91 0.13
92 0.13
93 0.13
94 0.14
95 0.15
96 0.15
97 0.14
98 0.12
99 0.11
100 0.1
101 0.09
102 0.09
103 0.08
104 0.08
105 0.08
106 0.07
107 0.08
108 0.07
109 0.1
110 0.1
111 0.15
112 0.16
113 0.15
114 0.16
115 0.15
116 0.17
117 0.15
118 0.17
119 0.18
120 0.25
121 0.31
122 0.34
123 0.39
124 0.47
125 0.57
126 0.66
127 0.72
128 0.76
129 0.81
130 0.88
131 0.93
132 0.91
133 0.91
134 0.9
135 0.87
136 0.81
137 0.77
138 0.7
139 0.61
140 0.54
141 0.46
142 0.38
143 0.3
144 0.27
145 0.22
146 0.2
147 0.18
148 0.18
149 0.16