Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R851

Protein Details
Accession A0A0J8R851   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-22GQSKRPFKNKEEKKSRGFGRSBasic
NLS Segment(s)
PositionSequence
5-33KRPFKNKEEKKSRGFGRSRHDDAGAGGRP
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036961  Kinesin_motor_dom_sf  
IPR001609  Myosin_head_motor_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016459  C:myosin complex  
GO:0003779  F:actin binding  
GO:0005524  F:ATP binding  
GO:0003774  F:cytoskeletal motor activity  
Pfam View protein in Pfam  
PF00063  Myosin_head  
PROSITE View protein in PROSITE  
PS51456  MYOSIN_MOTOR  
Amino Acid Sequences MGQSKRPFKNKEEKKSRGFGRSRHDDAGAGGRPQVKKAVFESTKKKEIGVSDLTLLSKVSNEAINENLKKRFEHGEIYTYIGHVLVSVNPFRDCKYFRPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.8
4 0.79
5 0.75
6 0.7
7 0.69
8 0.7
9 0.68
10 0.61
11 0.55
12 0.45
13 0.41
14 0.41
15 0.33
16 0.24
17 0.21
18 0.23
19 0.22
20 0.23
21 0.26
22 0.2
23 0.2
24 0.22
25 0.3
26 0.29
27 0.34
28 0.42
29 0.43
30 0.48
31 0.46
32 0.44
33 0.37
34 0.34
35 0.33
36 0.27
37 0.21
38 0.17
39 0.17
40 0.17
41 0.15
42 0.13
43 0.09
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.11
51 0.17
52 0.19
53 0.22
54 0.25
55 0.25
56 0.25
57 0.27
58 0.29
59 0.26
60 0.3
61 0.29
62 0.3
63 0.3
64 0.32
65 0.29
66 0.24
67 0.22
68 0.15
69 0.13
70 0.08
71 0.08
72 0.08
73 0.11
74 0.12
75 0.15
76 0.16
77 0.18
78 0.2
79 0.26
80 0.28