Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8U273

Protein Details
Accession A0A0J8U273    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-145ELETRNKPYSRNKIRIKTKRKRKIKGWPSQVHydrophilic
NLS Segment(s)
PositionSequence
112-140RKKELETRNKPYSRNKIRIKTKRKRKIKG
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
Amino Acid Sequences MRSLVSHPFAEADEDTGDTKQSQNYIHIRIQQRNGRKTLTTVQGLPKKFDQKKILKVIKKKFVKFIQAILNQEEPKGHVYLISLREGATRTEPVPTVGGYLKVLKLGSSPVRKKELETRNKPYSRNKIRIKTKRKRKIKGWPSQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.15
5 0.12
6 0.14
7 0.13
8 0.15
9 0.16
10 0.22
11 0.26
12 0.31
13 0.34
14 0.4
15 0.45
16 0.49
17 0.55
18 0.56
19 0.6
20 0.61
21 0.6
22 0.56
23 0.5
24 0.48
25 0.46
26 0.45
27 0.38
28 0.35
29 0.4
30 0.43
31 0.43
32 0.42
33 0.4
34 0.44
35 0.45
36 0.5
37 0.51
38 0.52
39 0.59
40 0.67
41 0.7
42 0.67
43 0.72
44 0.73
45 0.73
46 0.74
47 0.67
48 0.65
49 0.61
50 0.62
51 0.54
52 0.5
53 0.48
54 0.44
55 0.43
56 0.38
57 0.36
58 0.29
59 0.28
60 0.23
61 0.16
62 0.14
63 0.13
64 0.1
65 0.07
66 0.08
67 0.12
68 0.14
69 0.14
70 0.13
71 0.12
72 0.14
73 0.14
74 0.15
75 0.12
76 0.12
77 0.11
78 0.13
79 0.13
80 0.13
81 0.13
82 0.12
83 0.12
84 0.11
85 0.11
86 0.11
87 0.12
88 0.11
89 0.12
90 0.12
91 0.1
92 0.1
93 0.14
94 0.2
95 0.28
96 0.33
97 0.37
98 0.43
99 0.44
100 0.47
101 0.52
102 0.55
103 0.57
104 0.61
105 0.65
106 0.69
107 0.74
108 0.76
109 0.76
110 0.77
111 0.76
112 0.77
113 0.78
114 0.78
115 0.85
116 0.9
117 0.91
118 0.91
119 0.92
120 0.92
121 0.93
122 0.93
123 0.92
124 0.93
125 0.92