Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JLJ8

Protein Details
Accession G3JLJ8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-127GKSKKPEIPGMPRKPRKPRKPHQPCVKCTPKEBasic
NLS Segment(s)
PositionSequence
97-116KSKKPEIPGMPRKPRKPRKP
Subcellular Location(s) nucl 12, cyto 7, mito 6
Family & Domain DBs
KEGG cmt:CCM_06992  -  
Amino Acid Sequences MCTVFLVIGLCGHYVRLRYEPEKSDDCPEARKLALAGKPVVSCTGKIKEKKEFPNVVCRREPCWLPYKQKKYGWVCCKCGTSNKSNTNKCSGDKCGKSKKPEIPGMPRKPRKPRKPHQPCVKCTPKEQKSSESPRTPTNLDVATVDDTDGDEATSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.18
4 0.24
5 0.27
6 0.33
7 0.36
8 0.41
9 0.43
10 0.43
11 0.44
12 0.42
13 0.41
14 0.39
15 0.37
16 0.34
17 0.29
18 0.28
19 0.24
20 0.25
21 0.26
22 0.25
23 0.24
24 0.23
25 0.24
26 0.23
27 0.26
28 0.2
29 0.19
30 0.2
31 0.26
32 0.31
33 0.36
34 0.4
35 0.45
36 0.53
37 0.59
38 0.63
39 0.63
40 0.58
41 0.64
42 0.64
43 0.61
44 0.57
45 0.52
46 0.46
47 0.42
48 0.42
49 0.34
50 0.37
51 0.38
52 0.43
53 0.51
54 0.55
55 0.59
56 0.61
57 0.66
58 0.66
59 0.69
60 0.69
61 0.66
62 0.62
63 0.58
64 0.57
65 0.49
66 0.49
67 0.43
68 0.4
69 0.43
70 0.48
71 0.54
72 0.56
73 0.57
74 0.56
75 0.54
76 0.49
77 0.45
78 0.42
79 0.41
80 0.43
81 0.49
82 0.53
83 0.56
84 0.6
85 0.64
86 0.65
87 0.64
88 0.66
89 0.64
90 0.64
91 0.69
92 0.73
93 0.76
94 0.77
95 0.78
96 0.82
97 0.86
98 0.86
99 0.87
100 0.87
101 0.88
102 0.91
103 0.93
104 0.93
105 0.92
106 0.87
107 0.87
108 0.87
109 0.78
110 0.76
111 0.76
112 0.73
113 0.72
114 0.7
115 0.67
116 0.67
117 0.74
118 0.74
119 0.71
120 0.66
121 0.62
122 0.63
123 0.57
124 0.49
125 0.44
126 0.36
127 0.29
128 0.27
129 0.24
130 0.21
131 0.19
132 0.17
133 0.13
134 0.12
135 0.12
136 0.11
137 0.08