Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JF24

Protein Details
Accession G3JF24    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
196-219DAEAKPPKPKKIKAKKELEAGKNKBasic
NLS Segment(s)
PositionSequence
57-78PKQAPKPAPKQPSPPPEREKWS
200-219KPPKPKKIKAKKELEAGKNK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 1, pero 1, E.R. 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR041297  Crb2_Tudor  
IPR002999  Tudor  
Gene Ontology GO:0016020  C:membrane  
KEGG cmt:CCM_04452  -  
Pfam View protein in Pfam  
PF18115  Tudor_3  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSGLAELEAEKDQYKEQLDLVLGQLRDDPDNVELKALEQELQNFVQLLNENIAELKPKQAPKPAPKQPSPPPEREKWSRENHPAFKKTAPIPTPEEKDDTPVTYQVNDIVMAKWMSGDKGFYPAKITSITGSAAAPVYVVKFKSYDVTETIRSRDIRPVSNKRKAEALPAPPPASTPGLVSSAGATTYPNAGRDVDAEAKPPKPKKIKAKKELEAGKNKWQEFNSKSKFGKTQKKDSMFRTPEGVHGRGTILLIPVVFASILTLLPLVGFTGSGQAMRKDPSRNRHVYQVNEDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.2
5 0.2
6 0.2
7 0.21
8 0.22
9 0.2
10 0.19
11 0.21
12 0.19
13 0.19
14 0.19
15 0.18
16 0.16
17 0.19
18 0.19
19 0.18
20 0.16
21 0.16
22 0.18
23 0.17
24 0.16
25 0.14
26 0.16
27 0.18
28 0.19
29 0.18
30 0.15
31 0.14
32 0.16
33 0.15
34 0.14
35 0.12
36 0.12
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.16
43 0.2
44 0.24
45 0.28
46 0.37
47 0.46
48 0.52
49 0.62
50 0.67
51 0.7
52 0.7
53 0.75
54 0.76
55 0.77
56 0.75
57 0.73
58 0.7
59 0.68
60 0.71
61 0.7
62 0.68
63 0.66
64 0.67
65 0.67
66 0.71
67 0.73
68 0.74
69 0.75
70 0.72
71 0.67
72 0.6
73 0.57
74 0.51
75 0.5
76 0.43
77 0.38
78 0.4
79 0.43
80 0.46
81 0.41
82 0.42
83 0.33
84 0.36
85 0.33
86 0.28
87 0.23
88 0.21
89 0.2
90 0.16
91 0.16
92 0.13
93 0.12
94 0.11
95 0.1
96 0.08
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.08
105 0.07
106 0.13
107 0.14
108 0.13
109 0.16
110 0.16
111 0.17
112 0.17
113 0.17
114 0.11
115 0.12
116 0.12
117 0.09
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.1
131 0.11
132 0.12
133 0.13
134 0.15
135 0.19
136 0.19
137 0.21
138 0.22
139 0.22
140 0.22
141 0.26
142 0.26
143 0.28
144 0.35
145 0.45
146 0.5
147 0.58
148 0.58
149 0.52
150 0.55
151 0.5
152 0.48
153 0.44
154 0.41
155 0.38
156 0.4
157 0.39
158 0.34
159 0.34
160 0.29
161 0.24
162 0.18
163 0.13
164 0.11
165 0.12
166 0.12
167 0.12
168 0.1
169 0.08
170 0.08
171 0.07
172 0.06
173 0.05
174 0.08
175 0.09
176 0.09
177 0.1
178 0.1
179 0.11
180 0.11
181 0.15
182 0.17
183 0.16
184 0.19
185 0.21
186 0.24
187 0.31
188 0.33
189 0.39
190 0.43
191 0.51
192 0.59
193 0.67
194 0.75
195 0.78
196 0.85
197 0.82
198 0.83
199 0.84
200 0.81
201 0.8
202 0.73
203 0.73
204 0.69
205 0.64
206 0.59
207 0.52
208 0.51
209 0.46
210 0.52
211 0.49
212 0.49
213 0.5
214 0.5
215 0.58
216 0.59
217 0.65
218 0.62
219 0.66
220 0.69
221 0.76
222 0.77
223 0.75
224 0.76
225 0.7
226 0.64
227 0.58
228 0.49
229 0.48
230 0.47
231 0.43
232 0.32
233 0.29
234 0.28
235 0.23
236 0.23
237 0.17
238 0.12
239 0.11
240 0.1
241 0.09
242 0.08
243 0.08
244 0.07
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.04
256 0.04
257 0.04
258 0.07
259 0.08
260 0.1
261 0.12
262 0.14
263 0.16
264 0.2
265 0.25
266 0.32
267 0.4
268 0.48
269 0.56
270 0.62
271 0.63
272 0.69
273 0.71
274 0.69
275 0.69