Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8QXB3

Protein Details
Accession A0A0J8QXB3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSQKSFRTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTISWFPMHGSQYISSPFANRKCNMSSMKVIVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.85
4 0.86
5 0.86
6 0.83
7 0.81
8 0.77
9 0.74
10 0.69
11 0.67
12 0.67
13 0.61
14 0.58
15 0.53
16 0.49
17 0.44
18 0.41
19 0.35
20 0.29
21 0.26
22 0.22
23 0.2
24 0.18
25 0.16
26 0.17
27 0.15
28 0.14
29 0.15
30 0.15
31 0.17
32 0.18
33 0.18
34 0.14
35 0.16
36 0.22
37 0.26
38 0.32
39 0.31
40 0.34
41 0.36
42 0.43
43 0.44
44 0.43
45 0.44