Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8R611

Protein Details
Accession A0A0J8R611   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-35PEEFKEIRKEWKARKKEEENQRKAAEBasic
NLS Segment(s)
PositionSequence
14-32KEIRKEWKARKKEEENQRK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MQSHGAKRTPEEFKEIRKEWKARKKEEENQRKAAEERERAAAQSQGAENNAPPDPNNVTTAQQPPQPAPYPAGVRPQLPPIGYQPADGQVPSQYSNSTGSGLVYPSGNGQMPATYPTNYPHSPYGQGNQVYQQPPPPARPDGQLNNYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.59
4 0.6
5 0.67
6 0.69
7 0.75
8 0.76
9 0.76
10 0.82
11 0.83
12 0.83
13 0.86
14 0.87
15 0.84
16 0.82
17 0.75
18 0.68
19 0.59
20 0.58
21 0.55
22 0.48
23 0.43
24 0.4
25 0.39
26 0.36
27 0.36
28 0.3
29 0.22
30 0.2
31 0.18
32 0.14
33 0.14
34 0.14
35 0.12
36 0.13
37 0.13
38 0.11
39 0.1
40 0.12
41 0.14
42 0.15
43 0.17
44 0.16
45 0.17
46 0.2
47 0.23
48 0.21
49 0.21
50 0.2
51 0.19
52 0.22
53 0.22
54 0.2
55 0.19
56 0.19
57 0.2
58 0.2
59 0.25
60 0.22
61 0.21
62 0.22
63 0.22
64 0.21
65 0.19
66 0.18
67 0.15
68 0.2
69 0.19
70 0.18
71 0.16
72 0.16
73 0.16
74 0.15
75 0.13
76 0.09
77 0.1
78 0.11
79 0.11
80 0.09
81 0.1
82 0.13
83 0.13
84 0.12
85 0.11
86 0.1
87 0.11
88 0.11
89 0.1
90 0.08
91 0.08
92 0.07
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.09
99 0.12
100 0.13
101 0.13
102 0.14
103 0.16
104 0.23
105 0.23
106 0.26
107 0.26
108 0.27
109 0.3
110 0.32
111 0.32
112 0.33
113 0.35
114 0.33
115 0.33
116 0.37
117 0.34
118 0.33
119 0.35
120 0.35
121 0.36
122 0.4
123 0.41
124 0.39
125 0.4
126 0.44
127 0.47
128 0.49