Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JL03

Protein Details
Accession G3JL03    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-42PDTSPMPKDRHRKQRSNPDRKPITHBasic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.333
Family & Domain DBs
KEGG cmt:CCM_06797  -  
Amino Acid Sequences MCTSNCNTMELNGPDNKPDTSPMPKDRHRKQRSNPDRKPITHQMPVNQKSRPSPLVAGNTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.21
5 0.22
6 0.22
7 0.24
8 0.3
9 0.36
10 0.42
11 0.49
12 0.58
13 0.64
14 0.71
15 0.73
16 0.76
17 0.76
18 0.8
19 0.84
20 0.86
21 0.83
22 0.82
23 0.8
24 0.73
25 0.73
26 0.71
27 0.67
28 0.62
29 0.59
30 0.56
31 0.59
32 0.63
33 0.58
34 0.52
35 0.49
36 0.46
37 0.51
38 0.46
39 0.39
40 0.38
41 0.41