Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8QPV8

Protein Details
Accession A0A0J8QPV8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100SAKSHRPRFRPFRRLTNLRCRHBasic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 8.5, extr 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGSGETGLVFARPLPRFIARSSPGSQHKLSHSGSRPTRPLPLGNWLQKPYPPPAERRPPSTSSLAAFPLPAAIPPAPWSAKSHRPRFRPFRRLTNLRCRHGPYADGPLSFCFLNRGGTVKDSESERAFLSPPHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.28
4 0.3
5 0.37
6 0.33
7 0.37
8 0.39
9 0.43
10 0.45
11 0.48
12 0.47
13 0.42
14 0.42
15 0.43
16 0.42
17 0.43
18 0.42
19 0.46
20 0.49
21 0.52
22 0.52
23 0.47
24 0.51
25 0.45
26 0.42
27 0.35
28 0.37
29 0.39
30 0.41
31 0.43
32 0.4
33 0.38
34 0.38
35 0.38
36 0.36
37 0.37
38 0.33
39 0.34
40 0.41
41 0.5
42 0.51
43 0.55
44 0.55
45 0.49
46 0.51
47 0.47
48 0.4
49 0.3
50 0.29
51 0.24
52 0.19
53 0.15
54 0.11
55 0.09
56 0.08
57 0.06
58 0.07
59 0.06
60 0.06
61 0.08
62 0.1
63 0.1
64 0.11
65 0.15
66 0.18
67 0.28
68 0.37
69 0.45
70 0.5
71 0.57
72 0.66
73 0.73
74 0.79
75 0.8
76 0.77
77 0.78
78 0.8
79 0.81
80 0.8
81 0.81
82 0.79
83 0.73
84 0.72
85 0.67
86 0.62
87 0.55
88 0.49
89 0.41
90 0.41
91 0.39
92 0.34
93 0.3
94 0.27
95 0.26
96 0.24
97 0.2
98 0.14
99 0.12
100 0.14
101 0.14
102 0.17
103 0.17
104 0.19
105 0.21
106 0.2
107 0.22
108 0.23
109 0.26
110 0.25
111 0.25
112 0.24
113 0.23
114 0.22