Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SGG9

Protein Details
Accession A0A0C2SGG9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-74FPSALRQKRKTQTKRHETYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 3, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001529  DNA-dir_RNA_pol_M/15kDasu  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR034004  Zn_ribbon_RPA12_C  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0006379  P:mRNA cleavage  
Pfam View protein in Pfam  
PF02150  RNA_POL_M_15KD  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS00466  ZF_TFIIS_1  
PS51133  ZF_TFIIS_2  
CDD cd10507  Zn-ribbon_RPA12  
Amino Acid Sequences MTKLGSLLFCPDCGTLLSLPNEGETTVLCELCDYEEPASSYDNFETTTRSHPEAFPSALRQKRKTQTKRHETYDQGTLVSEKCPACGYLQAYSKEMQLRSVDEGSTIFYTCASCKHGWRVNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.17
4 0.18
5 0.18
6 0.18
7 0.18
8 0.17
9 0.14
10 0.13
11 0.09
12 0.11
13 0.11
14 0.11
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.1
21 0.09
22 0.11
23 0.12
24 0.13
25 0.14
26 0.13
27 0.13
28 0.12
29 0.12
30 0.11
31 0.11
32 0.12
33 0.12
34 0.16
35 0.18
36 0.19
37 0.2
38 0.19
39 0.22
40 0.23
41 0.23
42 0.19
43 0.21
44 0.27
45 0.3
46 0.35
47 0.35
48 0.4
49 0.48
50 0.58
51 0.62
52 0.66
53 0.72
54 0.78
55 0.8
56 0.78
57 0.76
58 0.69
59 0.63
60 0.57
61 0.47
62 0.36
63 0.3
64 0.25
65 0.19
66 0.16
67 0.17
68 0.11
69 0.11
70 0.12
71 0.12
72 0.12
73 0.16
74 0.18
75 0.2
76 0.26
77 0.27
78 0.28
79 0.28
80 0.3
81 0.3
82 0.28
83 0.25
84 0.21
85 0.22
86 0.25
87 0.25
88 0.22
89 0.18
90 0.18
91 0.18
92 0.17
93 0.15
94 0.11
95 0.1
96 0.12
97 0.12
98 0.15
99 0.17
100 0.19
101 0.23
102 0.33