Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2W589

Protein Details
Accession A0A0C2W589    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARECKKPKREKGACFECGKBasic
25-46VKDCPQKKRKGGSKGKIKKVEEBasic
NLS Segment(s)
PositionSequence
31-43KKRKGGSKGKIKK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MARECKKPKREKGACFECGKQGHVVKDCPQKKRKGGSKGKIKKVEEEPVEEPTEIEDEIEEEVGEDEDFTEGDDKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.68
4 0.64
5 0.56
6 0.48
7 0.43
8 0.38
9 0.36
10 0.35
11 0.36
12 0.36
13 0.45
14 0.49
15 0.52
16 0.56
17 0.58
18 0.61
19 0.68
20 0.7
21 0.7
22 0.75
23 0.75
24 0.8
25 0.81
26 0.83
27 0.82
28 0.74
29 0.7
30 0.64
31 0.63
32 0.53
33 0.49
34 0.42
35 0.37
36 0.38
37 0.31
38 0.26
39 0.19
40 0.18
41 0.12
42 0.1
43 0.07
44 0.06
45 0.06
46 0.07
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07