Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SSQ5

Protein Details
Accession A0A0C2SSQ5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-62ASSSLDLRRVRKRRRILKNNERLSHAHydrophilic
NLS Segment(s)
PositionSequence
45-52RVRKRRRI
Subcellular Location(s) nucl 7, plas 6, extr 5, mito 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010678  UTP25  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0034511  F:U3 snoRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF06862  UTP25  
Amino Acid Sequences MSTSLIPFHTMVSMLILVLDRNDLLSLLSIRRDLYLASSSLDLRRVRKRRRILKNNERLSHATKTTPDSPPEDVQDQGFTRPSVLILLLFRSSALDWFTAMTSHTPSPTYQIENQSRFLTEYGLPAGAVDKLTTAEPGTYPRDHVALTPNMKVQITTRVTLIRGGADHKLKMAMHAQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.07
6 0.08
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.1
14 0.1
15 0.12
16 0.12
17 0.12
18 0.13
19 0.13
20 0.11
21 0.13
22 0.14
23 0.13
24 0.13
25 0.14
26 0.15
27 0.16
28 0.21
29 0.21
30 0.24
31 0.34
32 0.43
33 0.51
34 0.6
35 0.69
36 0.74
37 0.82
38 0.87
39 0.88
40 0.9
41 0.91
42 0.91
43 0.83
44 0.77
45 0.7
46 0.64
47 0.57
48 0.47
49 0.39
50 0.31
51 0.33
52 0.34
53 0.33
54 0.3
55 0.29
56 0.31
57 0.3
58 0.31
59 0.27
60 0.23
61 0.2
62 0.21
63 0.18
64 0.15
65 0.15
66 0.12
67 0.11
68 0.1
69 0.1
70 0.07
71 0.07
72 0.06
73 0.05
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.08
90 0.08
91 0.09
92 0.1
93 0.1
94 0.13
95 0.15
96 0.18
97 0.19
98 0.27
99 0.34
100 0.35
101 0.37
102 0.34
103 0.33
104 0.3
105 0.27
106 0.21
107 0.14
108 0.14
109 0.12
110 0.12
111 0.11
112 0.1
113 0.1
114 0.08
115 0.07
116 0.06
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.12
125 0.16
126 0.16
127 0.17
128 0.18
129 0.19
130 0.18
131 0.19
132 0.22
133 0.25
134 0.27
135 0.28
136 0.29
137 0.3
138 0.29
139 0.28
140 0.24
141 0.26
142 0.27
143 0.25
144 0.25
145 0.25
146 0.26
147 0.28
148 0.27
149 0.19
150 0.17
151 0.19
152 0.24
153 0.26
154 0.26
155 0.25
156 0.28
157 0.26
158 0.28