Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SQE0

Protein Details
Accession A0A0C2SQE0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-91DAVVAGRKGKRRLKRQPRFVVEDEHydrophilic
NLS Segment(s)
PositionSequence
74-83RKGKRRLKRQ
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences MPSRSTELLLSLNGDTKLTKPWVTNWYRRWEILLDLMRSNWDQRQFFAALSINEYPYCAEQSYSTNGDAVVAGRKGKRRLKRQPRFVVEDENSSEDSDSWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.18
5 0.19
6 0.2
7 0.19
8 0.24
9 0.33
10 0.39
11 0.47
12 0.48
13 0.53
14 0.54
15 0.53
16 0.49
17 0.41
18 0.36
19 0.35
20 0.34
21 0.27
22 0.25
23 0.24
24 0.23
25 0.22
26 0.23
27 0.18
28 0.19
29 0.18
30 0.18
31 0.22
32 0.21
33 0.2
34 0.21
35 0.19
36 0.13
37 0.16
38 0.15
39 0.12
40 0.11
41 0.11
42 0.1
43 0.09
44 0.1
45 0.07
46 0.07
47 0.08
48 0.1
49 0.14
50 0.15
51 0.15
52 0.14
53 0.13
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.12
60 0.15
61 0.21
62 0.3
63 0.38
64 0.47
65 0.54
66 0.65
67 0.74
68 0.81
69 0.87
70 0.89
71 0.89
72 0.87
73 0.8
74 0.78
75 0.69
76 0.64
77 0.56
78 0.48
79 0.41
80 0.34
81 0.31