Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WT76

Protein Details
Accession A0A0C2WT76    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYCKGRVLGHKRAKRNSRPNQSLLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYCKGRVLGHKRAKRNSRPNQSLLQIEGVASKEDAQFYLGKRVAYVYKAKREIQGSKIRVIWGRVTRPHGSSGVVKSKFRSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.75
4 0.78
5 0.82
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.81
12 0.76
13 0.7
14 0.61
15 0.51
16 0.42
17 0.31
18 0.24
19 0.21
20 0.16
21 0.13
22 0.1
23 0.1
24 0.09
25 0.09
26 0.09
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.23
39 0.29
40 0.32
41 0.34
42 0.36
43 0.39
44 0.4
45 0.39
46 0.44
47 0.39
48 0.38
49 0.38
50 0.37
51 0.34
52 0.32
53 0.32
54 0.28
55 0.31
56 0.33
57 0.37
58 0.38
59 0.38
60 0.38
61 0.33
62 0.29
63 0.29
64 0.3
65 0.34
66 0.35
67 0.34
68 0.34
69 0.4
70 0.42
71 0.41
72 0.45
73 0.43
74 0.5
75 0.56
76 0.57
77 0.52
78 0.49
79 0.47
80 0.37
81 0.35
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13