Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WC35

Protein Details
Accession A0A0C2WC35    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
100-128NIGYKRSDPKHPCKKCWKKYAKPYSPVMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 9.666, nucl 9, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038910  Hua1-like  
Amino Acid Sequences MRRTGSGVSGSASGDVRSRSFEIEGLGTSSMPTEPSGSGSNGPNGGTDDDRPTTRSVPGHALLKDGKVLVYPKGFACPICAYMLIPTCRTTYSRIHTGFNIGYKRSDPKHPCKKCWKKYAKPYSPVMSYASDAGSLTTLQRPLPKPSSTPSSLCIPGEGIRREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.17
5 0.18
6 0.18
7 0.18
8 0.19
9 0.18
10 0.17
11 0.17
12 0.15
13 0.14
14 0.12
15 0.11
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.11
23 0.13
24 0.14
25 0.16
26 0.17
27 0.18
28 0.18
29 0.17
30 0.15
31 0.15
32 0.15
33 0.14
34 0.14
35 0.15
36 0.17
37 0.17
38 0.18
39 0.19
40 0.19
41 0.21
42 0.2
43 0.19
44 0.21
45 0.23
46 0.26
47 0.24
48 0.25
49 0.23
50 0.22
51 0.2
52 0.16
53 0.13
54 0.1
55 0.11
56 0.11
57 0.11
58 0.12
59 0.11
60 0.13
61 0.13
62 0.12
63 0.14
64 0.12
65 0.13
66 0.12
67 0.12
68 0.1
69 0.11
70 0.15
71 0.13
72 0.13
73 0.13
74 0.13
75 0.14
76 0.15
77 0.17
78 0.19
79 0.23
80 0.3
81 0.3
82 0.31
83 0.31
84 0.33
85 0.3
86 0.3
87 0.27
88 0.2
89 0.2
90 0.2
91 0.25
92 0.24
93 0.32
94 0.36
95 0.44
96 0.55
97 0.61
98 0.68
99 0.74
100 0.83
101 0.83
102 0.86
103 0.86
104 0.85
105 0.9
106 0.92
107 0.9
108 0.85
109 0.82
110 0.77
111 0.68
112 0.59
113 0.51
114 0.41
115 0.32
116 0.27
117 0.21
118 0.15
119 0.13
120 0.12
121 0.09
122 0.08
123 0.09
124 0.11
125 0.12
126 0.13
127 0.21
128 0.24
129 0.31
130 0.36
131 0.38
132 0.38
133 0.42
134 0.49
135 0.46
136 0.45
137 0.4
138 0.4
139 0.41
140 0.38
141 0.33
142 0.27
143 0.28
144 0.33