Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WTW1

Protein Details
Accession A0A0C2WTW1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-93AEERRKKRVNTRGGKEEKKKRVVPCPQPPLRBasic
NLS Segment(s)
PositionSequence
65-83ERRKKRVNTRGGKEEKKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKTVEKRKGGREYTYIYRRGHTKAGGNGWNNTNKRNTKQGMDNSQVVHPQKNNTHNEKGSEEAEERRKKRVNTRGGKEEKKKRVVPCPQPPLRHLHRAFLLVPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.52
4 0.51
5 0.49
6 0.47
7 0.46
8 0.4
9 0.39
10 0.38
11 0.44
12 0.46
13 0.45
14 0.45
15 0.44
16 0.48
17 0.44
18 0.41
19 0.42
20 0.41
21 0.42
22 0.47
23 0.45
24 0.41
25 0.48
26 0.53
27 0.51
28 0.5
29 0.49
30 0.42
31 0.4
32 0.4
33 0.33
34 0.28
35 0.22
36 0.22
37 0.26
38 0.32
39 0.37
40 0.38
41 0.42
42 0.41
43 0.42
44 0.4
45 0.36
46 0.29
47 0.26
48 0.21
49 0.21
50 0.29
51 0.35
52 0.35
53 0.4
54 0.45
55 0.47
56 0.55
57 0.6
58 0.61
59 0.63
60 0.7
61 0.73
62 0.77
63 0.82
64 0.82
65 0.83
66 0.82
67 0.8
68 0.79
69 0.75
70 0.77
71 0.78
72 0.78
73 0.79
74 0.8
75 0.79
76 0.77
77 0.73
78 0.71
79 0.68
80 0.68
81 0.59
82 0.55
83 0.51
84 0.5
85 0.48