Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XIG6

Protein Details
Accession A0A0C2XIG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-56YCKGRVLGHKRAKRNSRPNQSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 8, cyto 2, plas 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MSFWFLLLLPVLHCLSNIPPFQILTWIFYACRLYCKGRVLGHKRAKRNSRPNQSLLQIEGVTSKEDAQFYLGKRVAYVYKAKREIQGSKIRVIWGRVARPHGSSGVVKSKFRSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.2
4 0.2
5 0.19
6 0.19
7 0.2
8 0.2
9 0.24
10 0.21
11 0.18
12 0.19
13 0.18
14 0.17
15 0.18
16 0.2
17 0.15
18 0.18
19 0.19
20 0.21
21 0.25
22 0.29
23 0.33
24 0.35
25 0.45
26 0.48
27 0.55
28 0.61
29 0.64
30 0.68
31 0.72
32 0.76
33 0.77
34 0.81
35 0.81
36 0.82
37 0.8
38 0.76
39 0.71
40 0.64
41 0.55
42 0.45
43 0.37
44 0.26
45 0.2
46 0.17
47 0.13
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.09
55 0.11
56 0.11
57 0.18
58 0.19
59 0.17
60 0.17
61 0.19
62 0.18
63 0.18
64 0.25
65 0.24
66 0.3
67 0.35
68 0.36
69 0.39
70 0.43
71 0.44
72 0.44
73 0.48
74 0.43
75 0.42
76 0.42
77 0.4
78 0.37
79 0.35
80 0.34
81 0.3
82 0.33
83 0.33
84 0.36
85 0.36
86 0.35
87 0.35
88 0.3
89 0.27
90 0.24
91 0.25
92 0.3
93 0.32
94 0.31
95 0.32
96 0.38
97 0.4
98 0.41
99 0.47
100 0.44
101 0.52
102 0.57
103 0.59
104 0.53
105 0.5
106 0.47
107 0.37
108 0.35
109 0.26
110 0.2
111 0.16
112 0.15
113 0.14