Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SQ55

Protein Details
Accession A0A0C2SQ55   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-105RQLIKRCRAKNLKSRPTMKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MDIALFSDCIKSKYFFLNSNLRAKFEFIGLFAWWSREALIYGHENEYLFTECTYESNISAFADLFHSVCFDGRNEKPSNRLVKYARQLIKRCRAKNLKSRPTMKEVVTEMETWNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.36
4 0.44
5 0.47
6 0.54
7 0.53
8 0.46
9 0.43
10 0.4
11 0.35
12 0.27
13 0.23
14 0.14
15 0.15
16 0.13
17 0.14
18 0.12
19 0.12
20 0.11
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.1
27 0.11
28 0.12
29 0.13
30 0.13
31 0.13
32 0.12
33 0.13
34 0.13
35 0.1
36 0.09
37 0.09
38 0.08
39 0.08
40 0.1
41 0.09
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.07
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.12
59 0.14
60 0.2
61 0.23
62 0.24
63 0.28
64 0.34
65 0.41
66 0.37
67 0.43
68 0.41
69 0.46
70 0.52
71 0.57
72 0.57
73 0.57
74 0.62
75 0.65
76 0.72
77 0.73
78 0.69
79 0.7
80 0.74
81 0.75
82 0.78
83 0.8
84 0.8
85 0.8
86 0.85
87 0.8
88 0.77
89 0.74
90 0.64
91 0.6
92 0.52
93 0.47
94 0.42
95 0.37