Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WW55

Protein Details
Accession A0A0C2WW55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-44CQVPQHHKKPGKHKRTHSRDVSTBasic
NLS Segment(s)
PositionSequence
29-35KKPGKHK
Subcellular Location(s) plas 9, extr 7, mito 5, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MARTPSIFARLYSVWCVIMLVCQVPQHHKKPGKHKRTHSRDVSTCWRGLFVVDWLAPDENGLTTSTTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.12
5 0.12
6 0.1
7 0.08
8 0.08
9 0.09
10 0.11
11 0.17
12 0.24
13 0.26
14 0.35
15 0.42
16 0.47
17 0.57
18 0.67
19 0.71
20 0.73
21 0.79
22 0.81
23 0.83
24 0.86
25 0.82
26 0.79
27 0.72
28 0.69
29 0.68
30 0.6
31 0.53
32 0.43
33 0.36
34 0.28
35 0.25
36 0.2
37 0.13
38 0.13
39 0.12
40 0.13
41 0.14
42 0.15
43 0.14
44 0.13
45 0.12
46 0.08
47 0.09
48 0.09