Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SDS6

Protein Details
Accession A0A0C2SDS6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-64DTKHASRKGSGKKKTRRKDRALPEKYSBasic
NLS Segment(s)
PositionSequence
32-58PKKPRVDTKHASRKGSGKKKTRRKDRA
Subcellular Location(s) nucl 15.5, cyto_nucl 14.333, cyto 11, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MSNPVKSLIDSASKIIGEVRTLSDAEKDLPSPKKPRVDTKHASRKGSGKKKTRRKDRALPEKYSAEDVLWQDVVSVLGGRSVVDNALEEGSEFDSPYDTGDVLEVEIVSLSSTGEFLFNIGLHYNLLFLYSLSAFAKTRRAFTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.19
4 0.15
5 0.15
6 0.15
7 0.15
8 0.15
9 0.16
10 0.15
11 0.15
12 0.16
13 0.16
14 0.16
15 0.2
16 0.25
17 0.31
18 0.36
19 0.41
20 0.48
21 0.51
22 0.6
23 0.62
24 0.66
25 0.69
26 0.73
27 0.78
28 0.75
29 0.73
30 0.66
31 0.67
32 0.67
33 0.69
34 0.67
35 0.66
36 0.71
37 0.79
38 0.85
39 0.88
40 0.88
41 0.86
42 0.87
43 0.88
44 0.89
45 0.85
46 0.79
47 0.72
48 0.64
49 0.55
50 0.47
51 0.36
52 0.25
53 0.21
54 0.17
55 0.14
56 0.11
57 0.1
58 0.08
59 0.08
60 0.08
61 0.05
62 0.05
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.04
76 0.05
77 0.06
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.08
117 0.08
118 0.1
119 0.1
120 0.13
121 0.13
122 0.15
123 0.24
124 0.23