Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XD20

Protein Details
Accession A0A0C2XD20    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-34APSGGGKAAKKKKWSKGKVKDKAQHVVNHydrophilic
NLS Segment(s)
PositionSequence
4-28KAAAPSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences AKAKAAAPSGGGKAAKKKKWSKGKVKDKAQHVVNLDKVLYDRILKEVPTFKFISQSILIERLKVNGSLARVAIRHLEKDGQIRRIVHHSAQLIYSERT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.58
5 0.64
6 0.73
7 0.81
8 0.82
9 0.84
10 0.9
11 0.9
12 0.91
13 0.88
14 0.84
15 0.81
16 0.73
17 0.67
18 0.59
19 0.53
20 0.44
21 0.38
22 0.31
23 0.23
24 0.21
25 0.17
26 0.14
27 0.11
28 0.09
29 0.1
30 0.11
31 0.11
32 0.13
33 0.18
34 0.18
35 0.21
36 0.22
37 0.19
38 0.22
39 0.22
40 0.23
41 0.18
42 0.18
43 0.15
44 0.2
45 0.19
46 0.17
47 0.17
48 0.15
49 0.15
50 0.15
51 0.15
52 0.11
53 0.13
54 0.13
55 0.13
56 0.13
57 0.12
58 0.13
59 0.18
60 0.18
61 0.18
62 0.19
63 0.21
64 0.22
65 0.31
66 0.36
67 0.35
68 0.37
69 0.37
70 0.39
71 0.42
72 0.44
73 0.37
74 0.37
75 0.35
76 0.32
77 0.32
78 0.31