Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SJ35

Protein Details
Accession A0A0C2SJ35    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GYGNRMHPPHKPPKKRARSKTNRVALVSHydrophilic
NLS Segment(s)
PositionSequence
9-23PPHKPPKKRARSKTN
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MGYGNRMHPPHKPPKKRARSKTNRVALVSGFPASGSPPRSINKKTQRHRQRLVLDLRLGSTLEKGIKFCFAFYIEYRDFRRLKIPAALACIRLSELAFLVEIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.87
3 0.91
4 0.92
5 0.93
6 0.93
7 0.93
8 0.93
9 0.91
10 0.85
11 0.76
12 0.67
13 0.56
14 0.48
15 0.38
16 0.28
17 0.19
18 0.13
19 0.12
20 0.11
21 0.14
22 0.13
23 0.13
24 0.16
25 0.19
26 0.24
27 0.27
28 0.36
29 0.43
30 0.51
31 0.58
32 0.65
33 0.73
34 0.77
35 0.79
36 0.78
37 0.72
38 0.7
39 0.67
40 0.6
41 0.5
42 0.41
43 0.36
44 0.28
45 0.24
46 0.16
47 0.11
48 0.09
49 0.1
50 0.1
51 0.11
52 0.11
53 0.14
54 0.14
55 0.14
56 0.14
57 0.13
58 0.15
59 0.16
60 0.23
61 0.21
62 0.26
63 0.29
64 0.34
65 0.33
66 0.32
67 0.38
68 0.32
69 0.34
70 0.36
71 0.38
72 0.33
73 0.39
74 0.4
75 0.34
76 0.33
77 0.3
78 0.24
79 0.2
80 0.18
81 0.12
82 0.1
83 0.09