Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X245

Protein Details
Accession A0A0C2X245    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-93GNRKRRSSSHVRQPPRPYNIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 6, extr 3
Family & Domain DBs
Amino Acid Sequences MLAILLMALSAATALVFVHLFLPVLWRSLVVVDETLDAHEAGLALVASRNPFRETGPPANMAKLILLRHKIQTGNRKRRSSSHVRQPPRPYNISTTRPKTPWVRFGKSFGGMQFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.05
9 0.09
10 0.09
11 0.1
12 0.1
13 0.09
14 0.1
15 0.1
16 0.11
17 0.08
18 0.08
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.07
37 0.08
38 0.09
39 0.11
40 0.15
41 0.21
42 0.25
43 0.26
44 0.29
45 0.28
46 0.28
47 0.26
48 0.22
49 0.16
50 0.13
51 0.12
52 0.12
53 0.14
54 0.15
55 0.17
56 0.2
57 0.22
58 0.26
59 0.36
60 0.44
61 0.52
62 0.6
63 0.63
64 0.63
65 0.66
66 0.68
67 0.68
68 0.67
69 0.67
70 0.68
71 0.7
72 0.76
73 0.8
74 0.81
75 0.77
76 0.71
77 0.63
78 0.61
79 0.63
80 0.63
81 0.62
82 0.59
83 0.59
84 0.57
85 0.6
86 0.61
87 0.59
88 0.61
89 0.61
90 0.63
91 0.59
92 0.63
93 0.63
94 0.58
95 0.53