Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X578

Protein Details
Accession A0A0C2X578    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-161RGPGRTWPIHWKRLPKKRIKKLLKSIRDSCMSHydrophilic
NLS Segment(s)
PositionSequence
138-153IHWKRLPKKRIKKLLK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MAHYPSHPYSGSAGYIYANNELKTVERPPHRSKAYGHLKSFMPGTASMEVLSLTGPKVHSKAATVTPSSVSSPYSRTVVIREENDLWPHDGSGWTKSFFDGNTKRNDSLHSDWTPPGPSRWFDQFNSSNRGPGRTWPIHWKRLPKKRIKKLLKSIRDSCMSGYRRGLSKLSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.19
5 0.19
6 0.18
7 0.18
8 0.18
9 0.19
10 0.2
11 0.23
12 0.26
13 0.31
14 0.39
15 0.46
16 0.55
17 0.57
18 0.57
19 0.55
20 0.58
21 0.62
22 0.62
23 0.57
24 0.51
25 0.48
26 0.46
27 0.44
28 0.34
29 0.25
30 0.17
31 0.18
32 0.15
33 0.15
34 0.13
35 0.12
36 0.11
37 0.09
38 0.09
39 0.06
40 0.05
41 0.06
42 0.07
43 0.08
44 0.1
45 0.11
46 0.11
47 0.12
48 0.15
49 0.19
50 0.21
51 0.2
52 0.2
53 0.2
54 0.21
55 0.2
56 0.17
57 0.14
58 0.12
59 0.13
60 0.13
61 0.13
62 0.13
63 0.12
64 0.13
65 0.16
66 0.18
67 0.16
68 0.18
69 0.19
70 0.2
71 0.2
72 0.19
73 0.17
74 0.14
75 0.13
76 0.11
77 0.1
78 0.1
79 0.12
80 0.12
81 0.12
82 0.12
83 0.13
84 0.13
85 0.12
86 0.2
87 0.23
88 0.25
89 0.32
90 0.35
91 0.35
92 0.35
93 0.37
94 0.35
95 0.33
96 0.36
97 0.31
98 0.3
99 0.3
100 0.31
101 0.31
102 0.25
103 0.24
104 0.2
105 0.19
106 0.21
107 0.27
108 0.29
109 0.28
110 0.35
111 0.39
112 0.4
113 0.46
114 0.43
115 0.41
116 0.38
117 0.4
118 0.33
119 0.32
120 0.37
121 0.33
122 0.36
123 0.43
124 0.49
125 0.55
126 0.6
127 0.65
128 0.67
129 0.73
130 0.8
131 0.8
132 0.84
133 0.85
134 0.92
135 0.92
136 0.92
137 0.92
138 0.93
139 0.92
140 0.9
141 0.85
142 0.81
143 0.75
144 0.65
145 0.58
146 0.56
147 0.49
148 0.45
149 0.44
150 0.42
151 0.41
152 0.43
153 0.43