Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2TRS6

Protein Details
Accession A0A0C2TRS6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-83VTRGAGFRKEKNKKKRGSYRGGEITMHydrophilic
NLS Segment(s)
PositionSequence
63-74GFRKEKNKKKRG
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MQTNGNGDGKKGPRKTSTPFKRVDPLKVSVDVVTDNRYETKAGPSNDYGQRAHRDLIVTRGAGFRKEKNKKKRGSYRGGEITMQSHSFKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.63
4 0.66
5 0.65
6 0.64
7 0.63
8 0.65
9 0.64
10 0.63
11 0.57
12 0.51
13 0.46
14 0.44
15 0.4
16 0.32
17 0.29
18 0.22
19 0.18
20 0.15
21 0.12
22 0.11
23 0.11
24 0.12
25 0.12
26 0.11
27 0.16
28 0.2
29 0.2
30 0.22
31 0.23
32 0.28
33 0.3
34 0.32
35 0.27
36 0.24
37 0.27
38 0.26
39 0.25
40 0.21
41 0.2
42 0.18
43 0.21
44 0.19
45 0.16
46 0.15
47 0.18
48 0.18
49 0.19
50 0.22
51 0.25
52 0.34
53 0.44
54 0.53
55 0.61
56 0.7
57 0.75
58 0.84
59 0.88
60 0.87
61 0.87
62 0.83
63 0.82
64 0.81
65 0.75
66 0.65
67 0.55
68 0.47
69 0.41
70 0.36
71 0.28
72 0.2