Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SPU9

Protein Details
Accession A0A0C2SPU9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-78DPLKLPQFKPGRRRLWRKRHWTQRGIRDIDVHydrophilic
NLS Segment(s)
PositionSequence
56-67KPGRRRLWRKRH
Subcellular Location(s) mito 9, cyto_nucl 7.5, cyto 6.5, nucl 5.5, pero 5
Family & Domain DBs
Amino Acid Sequences MLSLLVTLLRELEPLHINVACVNYPARVAKIMIVTHYPPWSGWKLGDDPLKLPQFKPGRRRLWRKRHWTQRGIRDIDVTAHGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.14
5 0.15
6 0.16
7 0.13
8 0.12
9 0.12
10 0.1
11 0.11
12 0.12
13 0.12
14 0.11
15 0.11
16 0.12
17 0.15
18 0.15
19 0.14
20 0.15
21 0.16
22 0.16
23 0.17
24 0.15
25 0.11
26 0.15
27 0.15
28 0.14
29 0.13
30 0.13
31 0.14
32 0.18
33 0.22
34 0.19
35 0.18
36 0.24
37 0.28
38 0.27
39 0.25
40 0.3
41 0.35
42 0.4
43 0.49
44 0.52
45 0.58
46 0.68
47 0.79
48 0.81
49 0.84
50 0.88
51 0.89
52 0.9
53 0.91
54 0.91
55 0.9
56 0.89
57 0.88
58 0.88
59 0.82
60 0.72
61 0.64
62 0.55
63 0.47
64 0.43