Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W6Y9

Protein Details
Accession B2W6Y9    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-100GHSCYRPRRTGERKRKSVRGCBasic
181-204LVTPQRLQHKRHRIALKRRRAEASHydrophilic
NLS Segment(s)
PositionSequence
91-94ERKR
131-149KRLGPKRATKIRRFFGLSK
153-202VRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAE
230-233RKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNISYPNNGTQKMIEVDDERKLRVFMDRRMGHEVPGDSIGDEFKGYIMRITGGNDKQGFPMKQGVMHPTRVRLLLADGHSCYRPRRTGERKRKSVRGCIVGMDLSVLALSIVKKGDEDIPGLTDVVHPKRLGPKRATKIRRFFGLSKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILSKRINESKAAHDEARKRRASSMKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.23
4 0.23
5 0.26
6 0.32
7 0.33
8 0.29
9 0.28
10 0.27
11 0.25
12 0.3
13 0.33
14 0.33
15 0.42
16 0.44
17 0.47
18 0.55
19 0.54
20 0.46
21 0.45
22 0.39
23 0.31
24 0.29
25 0.24
26 0.16
27 0.16
28 0.15
29 0.1
30 0.09
31 0.07
32 0.06
33 0.08
34 0.07
35 0.08
36 0.08
37 0.09
38 0.1
39 0.13
40 0.19
41 0.19
42 0.25
43 0.25
44 0.26
45 0.27
46 0.34
47 0.31
48 0.26
49 0.31
50 0.26
51 0.28
52 0.29
53 0.33
54 0.29
55 0.35
56 0.34
57 0.3
58 0.31
59 0.29
60 0.27
61 0.2
62 0.19
63 0.18
64 0.18
65 0.18
66 0.17
67 0.18
68 0.19
69 0.21
70 0.21
71 0.22
72 0.24
73 0.27
74 0.37
75 0.46
76 0.56
77 0.65
78 0.74
79 0.79
80 0.81
81 0.85
82 0.8
83 0.79
84 0.74
85 0.68
86 0.58
87 0.48
88 0.42
89 0.34
90 0.28
91 0.19
92 0.12
93 0.06
94 0.05
95 0.04
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.08
105 0.08
106 0.09
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.08
113 0.11
114 0.12
115 0.13
116 0.13
117 0.14
118 0.23
119 0.29
120 0.34
121 0.36
122 0.44
123 0.51
124 0.62
125 0.69
126 0.68
127 0.71
128 0.69
129 0.67
130 0.63
131 0.56
132 0.53
133 0.52
134 0.45
135 0.4
136 0.41
137 0.39
138 0.34
139 0.34
140 0.29
141 0.26
142 0.26
143 0.26
144 0.31
145 0.31
146 0.38
147 0.47
148 0.54
149 0.54
150 0.56
151 0.58
152 0.53
153 0.56
154 0.55
155 0.49
156 0.5
157 0.48
158 0.53
159 0.58
160 0.57
161 0.58
162 0.59
163 0.64
164 0.59
165 0.62
166 0.59
167 0.59
168 0.66
169 0.67
170 0.66
171 0.61
172 0.67
173 0.7
174 0.69
175 0.7
176 0.72
177 0.7
178 0.73
179 0.78
180 0.77
181 0.81
182 0.85
183 0.86
184 0.83
185 0.81
186 0.8
187 0.74
188 0.71
189 0.69
190 0.66
191 0.61
192 0.55
193 0.52
194 0.45
195 0.41
196 0.34
197 0.26
198 0.21
199 0.18
200 0.16
201 0.16
202 0.19
203 0.23
204 0.28
205 0.31
206 0.31
207 0.34
208 0.37
209 0.44
210 0.47
211 0.48
212 0.45
213 0.49
214 0.56
215 0.6
216 0.66
217 0.63
218 0.58
219 0.61