Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WJI6

Protein Details
Accession A0A0C2WJI6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
225-294SVRGCVPKKPKPSPPGKPAPKKPTVQKPRPGKPQRPSNNKPKPASPKMPAKPKTRGPRKLRARSNKGLKHBasic
NLS Segment(s)
PositionSequence
231-294PKKPKPSPPGKPAPKKPTVQKPRPGKPQRPSNNKPKPASPKMPAKPKTRGPRKLRARSNKGLKH
Subcellular Location(s) mito 16.5, cyto_mito 9.833, extr 6, cyto_nucl 2.333, cyto 2
Family & Domain DBs
Amino Acid Sequences MSLKPFILQSLFVLLFCTSFLYAVDPHHSPFRLDSYDGLEAYVGSIDYPTTQITREVLISEAKRVWDFLPKTGGPAMVSALYTANEKKIYFATSIKGPAAKKDLGFPPLLTNALDSCKKELANQGAHIFSGRCAELMVIAEWYYQNGGGHPDSHVQLPASGKLIVAVNHDRQVIEPCSENTPVPSKGVPFGCADVLPKLGFKADEIVETDPESCQIRRRSFGGLSVRGCVPKKPKPSPPGKPAPKKPTVQKPRPGKPQRPSNNKPKPASPKMPAKPKTRGPRKLRARSNKGLKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.15
5 0.09
6 0.09
7 0.09
8 0.1
9 0.12
10 0.14
11 0.18
12 0.17
13 0.19
14 0.25
15 0.25
16 0.24
17 0.25
18 0.28
19 0.27
20 0.27
21 0.27
22 0.27
23 0.29
24 0.28
25 0.25
26 0.2
27 0.16
28 0.15
29 0.14
30 0.08
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.07
37 0.08
38 0.09
39 0.1
40 0.11
41 0.13
42 0.13
43 0.12
44 0.13
45 0.17
46 0.17
47 0.19
48 0.2
49 0.2
50 0.19
51 0.2
52 0.2
53 0.23
54 0.24
55 0.24
56 0.3
57 0.28
58 0.3
59 0.3
60 0.29
61 0.21
62 0.19
63 0.17
64 0.11
65 0.11
66 0.09
67 0.09
68 0.08
69 0.1
70 0.1
71 0.11
72 0.12
73 0.12
74 0.13
75 0.14
76 0.16
77 0.16
78 0.17
79 0.17
80 0.18
81 0.2
82 0.2
83 0.22
84 0.21
85 0.22
86 0.25
87 0.25
88 0.22
89 0.25
90 0.27
91 0.26
92 0.26
93 0.23
94 0.21
95 0.2
96 0.21
97 0.15
98 0.13
99 0.11
100 0.14
101 0.15
102 0.14
103 0.15
104 0.16
105 0.16
106 0.17
107 0.22
108 0.24
109 0.25
110 0.26
111 0.26
112 0.24
113 0.24
114 0.22
115 0.17
116 0.12
117 0.11
118 0.09
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.07
135 0.07
136 0.07
137 0.08
138 0.1
139 0.1
140 0.11
141 0.11
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.1
151 0.09
152 0.12
153 0.15
154 0.14
155 0.16
156 0.17
157 0.16
158 0.16
159 0.19
160 0.17
161 0.15
162 0.15
163 0.15
164 0.17
165 0.18
166 0.18
167 0.15
168 0.18
169 0.18
170 0.18
171 0.17
172 0.15
173 0.19
174 0.2
175 0.2
176 0.16
177 0.17
178 0.16
179 0.15
180 0.16
181 0.12
182 0.12
183 0.11
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.11
190 0.1
191 0.11
192 0.13
193 0.14
194 0.14
195 0.15
196 0.15
197 0.11
198 0.12
199 0.13
200 0.12
201 0.18
202 0.25
203 0.28
204 0.31
205 0.33
206 0.37
207 0.35
208 0.42
209 0.43
210 0.41
211 0.39
212 0.38
213 0.38
214 0.37
215 0.37
216 0.36
217 0.36
218 0.38
219 0.47
220 0.53
221 0.6
222 0.66
223 0.75
224 0.79
225 0.81
226 0.84
227 0.85
228 0.87
229 0.88
230 0.88
231 0.85
232 0.82
233 0.82
234 0.82
235 0.83
236 0.82
237 0.81
238 0.82
239 0.84
240 0.88
241 0.89
242 0.88
243 0.87
244 0.88
245 0.89
246 0.89
247 0.88
248 0.88
249 0.89
250 0.88
251 0.83
252 0.82
253 0.81
254 0.81
255 0.81
256 0.78
257 0.78
258 0.78
259 0.84
260 0.82
261 0.8
262 0.79
263 0.8
264 0.83
265 0.83
266 0.84
267 0.82
268 0.85
269 0.88
270 0.9
271 0.91
272 0.91
273 0.89
274 0.89