Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2W9N0

Protein Details
Accession A0A0C2W9N0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-43QDLVPWEKRKRLPRSFRVKNVDRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences ETTETQALIDCGAEGRFIHQDLVPWEKRKRLPRSFRVKNVDRSPNTAGRITHGIWVAYEFAGKKFKDMFHITDLGDQKIILGMPWLERHNPLIDWRRKTVVIPKDPSRHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.12
4 0.12
5 0.14
6 0.13
7 0.16
8 0.18
9 0.26
10 0.28
11 0.32
12 0.35
13 0.4
14 0.47
15 0.54
16 0.61
17 0.64
18 0.69
19 0.73
20 0.82
21 0.84
22 0.86
23 0.85
24 0.81
25 0.8
26 0.78
27 0.77
28 0.67
29 0.64
30 0.59
31 0.54
32 0.5
33 0.43
34 0.35
35 0.28
36 0.29
37 0.24
38 0.22
39 0.18
40 0.16
41 0.13
42 0.14
43 0.12
44 0.09
45 0.09
46 0.06
47 0.08
48 0.13
49 0.13
50 0.14
51 0.16
52 0.17
53 0.22
54 0.25
55 0.26
56 0.25
57 0.27
58 0.26
59 0.29
60 0.3
61 0.24
62 0.21
63 0.18
64 0.14
65 0.13
66 0.12
67 0.06
68 0.06
69 0.06
70 0.08
71 0.12
72 0.14
73 0.14
74 0.16
75 0.18
76 0.2
77 0.2
78 0.26
79 0.34
80 0.4
81 0.44
82 0.47
83 0.49
84 0.47
85 0.5
86 0.51
87 0.51
88 0.52
89 0.55
90 0.6