Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WRJ1

Protein Details
Accession A0A0C2WRJ1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-66TSLWRKSSKKMARKMHKKSSSSHydrophilic
NLS Segment(s)
PositionSequence
49-63RKSSKKMARKMHKKS
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MWKMKTPRHAGSKAPCYAGQDKALDSVYDQICVPGMAGMVHHLTTSLWRKSSKKMARKMHKKSSSSCKARSWHRRLSSLSHVRLLSAIDYICSVIYGTCHHSRCICVSNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.52
3 0.49
4 0.49
5 0.45
6 0.4
7 0.32
8 0.29
9 0.28
10 0.27
11 0.21
12 0.18
13 0.21
14 0.17
15 0.16
16 0.16
17 0.13
18 0.13
19 0.13
20 0.12
21 0.06
22 0.05
23 0.04
24 0.04
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.1
32 0.16
33 0.17
34 0.18
35 0.22
36 0.24
37 0.29
38 0.4
39 0.44
40 0.47
41 0.54
42 0.62
43 0.7
44 0.78
45 0.82
46 0.82
47 0.82
48 0.77
49 0.74
50 0.75
51 0.74
52 0.7
53 0.66
54 0.61
55 0.59
56 0.66
57 0.7
58 0.67
59 0.66
60 0.65
61 0.66
62 0.62
63 0.63
64 0.63
65 0.61
66 0.56
67 0.51
68 0.46
69 0.4
70 0.38
71 0.32
72 0.22
73 0.15
74 0.12
75 0.08
76 0.09
77 0.09
78 0.08
79 0.07
80 0.07
81 0.05
82 0.06
83 0.09
84 0.14
85 0.21
86 0.23
87 0.25
88 0.27
89 0.3
90 0.34