Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WPS1

Protein Details
Accession A0A0C2WPS1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60LENTLRSQGKWQDKKQKPGNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF13424  TPR_12  
Amino Acid Sequences MLHAWQGKWEKAEELRIQVVEGRVSLLGEGHPETIQVMESLENTLRSQGKWQDKKQKPGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.3
4 0.29
5 0.27
6 0.25
7 0.18
8 0.15
9 0.11
10 0.09
11 0.09
12 0.08
13 0.06
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.07
28 0.08
29 0.09
30 0.09
31 0.13
32 0.14
33 0.14
34 0.2
35 0.27
36 0.38
37 0.46
38 0.56
39 0.63
40 0.7