Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VQX1

Protein Details
Accession B2VQX1   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-30DTEPGRRKKTDKKSMEYLIKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MSARKEGGADTEPGRRKKTDKKSMEYLIKSGLAGGFAGCAAKTVVGPLDRVKILFQTRNPEFAKYAGSWSGFPTAIRDIYASTGVRGLFKGHSATLLRIFPYAGIKFLAYEQIRGRLIKTKAQETPGRRFLSGSLAGMMSVFMTYPLEVIRVRLAFETKESGRSSLSSIIRKIYAERAPAVSSSHNTNIPVVATATHVAQKVTPSSGLPNFFRGFTPTLLGMIPYAGASFLAHDSMSDLMRIPILAPYTTLPNTSREESSTTSHKPAQLRYWAELFTGGIAGFVSQTVSYPLEVIRRRMQVGGVVGDGRRLSIPEVARRVYAERGYKGFFVGLSIGYVKVVPMAAVSFYAYERGKYYLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.51
4 0.59
5 0.67
6 0.69
7 0.7
8 0.73
9 0.78
10 0.83
11 0.84
12 0.77
13 0.68
14 0.61
15 0.52
16 0.44
17 0.36
18 0.27
19 0.18
20 0.14
21 0.12
22 0.08
23 0.07
24 0.08
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.08
31 0.11
32 0.12
33 0.14
34 0.15
35 0.2
36 0.2
37 0.21
38 0.2
39 0.23
40 0.29
41 0.33
42 0.34
43 0.39
44 0.4
45 0.48
46 0.48
47 0.45
48 0.4
49 0.35
50 0.35
51 0.27
52 0.28
53 0.23
54 0.23
55 0.21
56 0.22
57 0.24
58 0.2
59 0.19
60 0.18
61 0.18
62 0.17
63 0.17
64 0.15
65 0.13
66 0.14
67 0.18
68 0.15
69 0.12
70 0.14
71 0.14
72 0.14
73 0.14
74 0.15
75 0.12
76 0.13
77 0.15
78 0.12
79 0.16
80 0.16
81 0.18
82 0.2
83 0.2
84 0.19
85 0.18
86 0.18
87 0.15
88 0.19
89 0.17
90 0.14
91 0.13
92 0.13
93 0.13
94 0.13
95 0.2
96 0.15
97 0.18
98 0.18
99 0.22
100 0.24
101 0.24
102 0.25
103 0.26
104 0.28
105 0.3
106 0.32
107 0.33
108 0.35
109 0.4
110 0.45
111 0.43
112 0.49
113 0.52
114 0.5
115 0.44
116 0.41
117 0.37
118 0.36
119 0.32
120 0.24
121 0.16
122 0.14
123 0.14
124 0.13
125 0.12
126 0.06
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.05
135 0.05
136 0.06
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.1
143 0.11
144 0.15
145 0.13
146 0.17
147 0.17
148 0.17
149 0.16
150 0.17
151 0.17
152 0.2
153 0.23
154 0.21
155 0.22
156 0.22
157 0.22
158 0.22
159 0.22
160 0.21
161 0.2
162 0.18
163 0.19
164 0.19
165 0.18
166 0.18
167 0.19
168 0.14
169 0.12
170 0.13
171 0.14
172 0.14
173 0.14
174 0.14
175 0.13
176 0.12
177 0.11
178 0.08
179 0.07
180 0.06
181 0.06
182 0.07
183 0.09
184 0.09
185 0.09
186 0.09
187 0.1
188 0.1
189 0.1
190 0.1
191 0.08
192 0.12
193 0.14
194 0.17
195 0.17
196 0.2
197 0.19
198 0.2
199 0.2
200 0.19
201 0.18
202 0.16
203 0.17
204 0.13
205 0.13
206 0.12
207 0.12
208 0.09
209 0.07
210 0.06
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.06
222 0.07
223 0.07
224 0.06
225 0.07
226 0.06
227 0.07
228 0.07
229 0.06
230 0.07
231 0.08
232 0.08
233 0.08
234 0.09
235 0.13
236 0.13
237 0.15
238 0.14
239 0.17
240 0.21
241 0.22
242 0.23
243 0.2
244 0.23
245 0.24
246 0.26
247 0.29
248 0.28
249 0.3
250 0.32
251 0.35
252 0.35
253 0.37
254 0.4
255 0.42
256 0.43
257 0.41
258 0.41
259 0.37
260 0.33
261 0.29
262 0.23
263 0.15
264 0.12
265 0.09
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.05
272 0.04
273 0.05
274 0.07
275 0.08
276 0.08
277 0.09
278 0.1
279 0.18
280 0.2
281 0.25
282 0.3
283 0.33
284 0.34
285 0.34
286 0.34
287 0.3
288 0.3
289 0.27
290 0.21
291 0.19
292 0.18
293 0.19
294 0.18
295 0.15
296 0.12
297 0.12
298 0.12
299 0.16
300 0.21
301 0.26
302 0.32
303 0.32
304 0.33
305 0.34
306 0.35
307 0.35
308 0.37
309 0.35
310 0.35
311 0.37
312 0.39
313 0.37
314 0.36
315 0.31
316 0.24
317 0.19
318 0.16
319 0.13
320 0.12
321 0.12
322 0.11
323 0.11
324 0.11
325 0.09
326 0.09
327 0.09
328 0.07
329 0.07
330 0.07
331 0.07
332 0.08
333 0.09
334 0.09
335 0.09
336 0.15
337 0.15
338 0.15
339 0.17
340 0.19