Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WXR9

Protein Details
Accession A0A0C2WXR9    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNNWCCRRRCRSCSLSVKKNRYLLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004203  Cyt_c_oxidase_su4_fam  
IPR036639  Cyt_c_oxidase_su4_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02936  COX4  
Amino Acid Sequences MNNWCCRRRCRSCSLSVKKNRYLLRCISPVQARQQLEDFHVYYCSGDRLALLGFYIAFRQLCSFLPPKTATTEWQKAENQRAWEMNINPIFGVSSPDYKGKSFKDWGHTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.83
4 0.84
5 0.81
6 0.81
7 0.77
8 0.7
9 0.66
10 0.62
11 0.59
12 0.54
13 0.5
14 0.48
15 0.47
16 0.45
17 0.46
18 0.47
19 0.41
20 0.38
21 0.39
22 0.34
23 0.31
24 0.31
25 0.24
26 0.17
27 0.18
28 0.16
29 0.13
30 0.13
31 0.11
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.07
49 0.11
50 0.13
51 0.13
52 0.17
53 0.19
54 0.19
55 0.22
56 0.23
57 0.23
58 0.29
59 0.35
60 0.32
61 0.36
62 0.38
63 0.38
64 0.45
65 0.45
66 0.4
67 0.37
68 0.37
69 0.35
70 0.38
71 0.34
72 0.35
73 0.32
74 0.29
75 0.25
76 0.24
77 0.21
78 0.15
79 0.19
80 0.13
81 0.15
82 0.17
83 0.21
84 0.23
85 0.24
86 0.3
87 0.29
88 0.34
89 0.38
90 0.42
91 0.46