Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WF70

Protein Details
Accession A0A0C2WF70    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPAKPRSPTLSPRKTRNQRKRTLSVLSHydrophilic
NLS Segment(s)
PositionSequence
12-21PRKTRNQRKR
32-37KVAKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPAKPRSPTLSPRKTRNQRKRTLSVLSDKSIKVAKKRREEEEEEERSARAEDDDDDDDVNEEGAKKTGKQRCKNPGDTGSHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.88
4 0.87
5 0.86
6 0.88
7 0.86
8 0.81
9 0.77
10 0.71
11 0.68
12 0.62
13 0.55
14 0.5
15 0.43
16 0.39
17 0.36
18 0.33
19 0.33
20 0.38
21 0.44
22 0.5
23 0.55
24 0.59
25 0.61
26 0.64
27 0.62
28 0.62
29 0.58
30 0.5
31 0.45
32 0.39
33 0.33
34 0.27
35 0.21
36 0.12
37 0.08
38 0.07
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.12
45 0.11
46 0.1
47 0.07
48 0.07
49 0.07
50 0.09
51 0.1
52 0.12
53 0.21
54 0.29
55 0.39
56 0.48
57 0.57
58 0.66
59 0.75
60 0.79
61 0.78
62 0.79