Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2VZ38

Protein Details
Accession A0A0C2VZ38   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-58AEEKRTELRRCRFKRQRNRYIRECSLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MARLVQSYYNRGEVSDDGGLVKHATPQVNHAAEEKRTELRRCRFKRQRNRYIRECSLAATLGLMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.16
4 0.13
5 0.13
6 0.13
7 0.11
8 0.1
9 0.09
10 0.11
11 0.12
12 0.12
13 0.15
14 0.22
15 0.22
16 0.22
17 0.22
18 0.22
19 0.21
20 0.23
21 0.22
22 0.2
23 0.23
24 0.27
25 0.33
26 0.4
27 0.5
28 0.55
29 0.64
30 0.7
31 0.76
32 0.84
33 0.86
34 0.88
35 0.89
36 0.91
37 0.89
38 0.88
39 0.83
40 0.77
41 0.66
42 0.57
43 0.49
44 0.41
45 0.31