Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SXK0

Protein Details
Accession A0A0C2SXK0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-78STEILFCYKKRRKADKRFFVFLKHydrophilic
NLS Segment(s)
PositionSequence
65-69KRRKA
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MNLLQPSVNVAELNWGAGLPPGNIPRPDIILAADCVYFEPAFPLLVQTLDDLSDSSTEILFCYKKRRKADKRFFVFLKKRFSWEDVKDDPDKIIYNREAISLLRLYKIPRTRVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.11
5 0.12
6 0.08
7 0.12
8 0.14
9 0.18
10 0.19
11 0.2
12 0.2
13 0.22
14 0.22
15 0.18
16 0.16
17 0.14
18 0.14
19 0.14
20 0.12
21 0.1
22 0.09
23 0.1
24 0.09
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.08
49 0.19
50 0.24
51 0.32
52 0.42
53 0.53
54 0.62
55 0.73
56 0.83
57 0.83
58 0.84
59 0.83
60 0.77
61 0.76
62 0.74
63 0.68
64 0.66
65 0.57
66 0.54
67 0.5
68 0.52
69 0.5
70 0.46
71 0.47
72 0.41
73 0.45
74 0.43
75 0.41
76 0.38
77 0.31
78 0.3
79 0.23
80 0.26
81 0.23
82 0.24
83 0.23
84 0.24
85 0.23
86 0.2
87 0.23
88 0.2
89 0.19
90 0.18
91 0.2
92 0.21
93 0.29
94 0.36