Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X515

Protein Details
Accession A0A0C2X515    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-74GTVQQRKRQRVPTCGRRREHBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 16.5, cyto 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MGGVDKGLKNTCMVAQIDSEVKEKLPRPRAAIPQGRLAQDAIRNAYFIICQRPDGTVQQRKRQRVPTCGRRREHDGDISQSVSII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.18
4 0.19
5 0.19
6 0.2
7 0.15
8 0.15
9 0.19
10 0.22
11 0.29
12 0.36
13 0.37
14 0.42
15 0.48
16 0.55
17 0.59
18 0.62
19 0.55
20 0.54
21 0.54
22 0.49
23 0.43
24 0.36
25 0.29
26 0.23
27 0.23
28 0.17
29 0.14
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.13
36 0.11
37 0.12
38 0.13
39 0.14
40 0.16
41 0.22
42 0.3
43 0.34
44 0.39
45 0.48
46 0.55
47 0.61
48 0.66
49 0.7
50 0.68
51 0.69
52 0.74
53 0.76
54 0.8
55 0.82
56 0.79
57 0.76
58 0.77
59 0.73
60 0.69
61 0.66
62 0.6
63 0.56
64 0.55
65 0.49