Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SB45

Protein Details
Accession A0A0C2SB45    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKAWSNEDYKKRRTRRRIYHEMPTTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MKAWSNEDYKKRRTRRRIYHEMPTTSLGRRKPVLYLRQLHRREIPDTVSITPQDCPSSSLFLLSLRRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.9
4 0.91
5 0.87
6 0.87
7 0.84
8 0.76
9 0.67
10 0.59
11 0.51
12 0.43
13 0.42
14 0.33
15 0.28
16 0.27
17 0.25
18 0.27
19 0.32
20 0.35
21 0.37
22 0.43
23 0.46
24 0.54
25 0.55
26 0.53
27 0.51
28 0.48
29 0.44
30 0.39
31 0.36
32 0.29
33 0.3
34 0.28
35 0.25
36 0.22
37 0.21
38 0.2
39 0.19
40 0.17
41 0.15
42 0.16
43 0.16
44 0.2
45 0.19
46 0.19
47 0.17
48 0.19
49 0.25