Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WYH1

Protein Details
Accession A0A0C2WYH1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-83TTEPKGREIRAKRKCRRKDGPETRHLTTBasic
NLS Segment(s)
PositionSequence
33-41GGKKRRRDA
59-73PKGREIRAKRKCRRK
Subcellular Location(s) nucl 22, cyto_nucl 14.833, mito_nucl 11.999
Family & Domain DBs
Amino Acid Sequences MQVEVPFVPASQREPRILDKRVEDTIVVVGKFGGKKRRRDAPSKDMSEQSARGSVTTEPKGREIRAKRKCRRKDGPETRHLTTDSIIIRDQKDFDFSAVPNILDDPSNPAEEPSRPKKVKGSVSSRGNFSAAQEAQGVPRGEPFSRVDLVCISVKTPSIELHASSSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.48
4 0.51
5 0.51
6 0.48
7 0.49
8 0.48
9 0.45
10 0.36
11 0.29
12 0.29
13 0.27
14 0.21
15 0.17
16 0.14
17 0.17
18 0.19
19 0.23
20 0.29
21 0.32
22 0.42
23 0.49
24 0.59
25 0.62
26 0.69
27 0.73
28 0.73
29 0.76
30 0.73
31 0.7
32 0.62
33 0.58
34 0.52
35 0.44
36 0.35
37 0.28
38 0.22
39 0.19
40 0.18
41 0.18
42 0.2
43 0.24
44 0.25
45 0.23
46 0.28
47 0.3
48 0.3
49 0.37
50 0.4
51 0.46
52 0.53
53 0.63
54 0.68
55 0.76
56 0.84
57 0.85
58 0.86
59 0.85
60 0.86
61 0.87
62 0.86
63 0.85
64 0.81
65 0.72
66 0.64
67 0.55
68 0.44
69 0.33
70 0.28
71 0.19
72 0.15
73 0.14
74 0.14
75 0.14
76 0.14
77 0.15
78 0.11
79 0.13
80 0.12
81 0.12
82 0.12
83 0.11
84 0.14
85 0.14
86 0.13
87 0.11
88 0.11
89 0.11
90 0.09
91 0.09
92 0.11
93 0.11
94 0.12
95 0.12
96 0.12
97 0.14
98 0.17
99 0.24
100 0.26
101 0.35
102 0.35
103 0.37
104 0.43
105 0.5
106 0.56
107 0.57
108 0.58
109 0.58
110 0.66
111 0.66
112 0.62
113 0.55
114 0.47
115 0.39
116 0.32
117 0.3
118 0.22
119 0.2
120 0.19
121 0.18
122 0.18
123 0.24
124 0.23
125 0.15
126 0.19
127 0.2
128 0.2
129 0.23
130 0.24
131 0.23
132 0.26
133 0.25
134 0.23
135 0.21
136 0.24
137 0.23
138 0.21
139 0.18
140 0.16
141 0.17
142 0.17
143 0.18
144 0.16
145 0.18
146 0.19
147 0.2
148 0.22